DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gucy2d

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:XP_005165318.1 Gene:gucy2d / 140426 ZFINID:ZDB-GENE-011128-9 Length:1141 Species:Danio rerio


Alignment Length:293 Identity:87/293 - (29%)
Similarity:146/293 - (49%) Gaps:38/293 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1327 LVEVTSRLDFIWKEQAERELTNMKSNRALNDTLIKNILPDHVATYY-----LSDEHTDELYSKMH 1386
            |.:.:|.|:.:.:|:.|    .::..|...|.|:..:||..||...     :..||..|:.....
Zfish   862 LEQYSSNLEDLIRERTE----ELEVERQKTDALLAQMLPKSVALALKTGKPVKPEHFAEVTLYFS 922

  Fly  1387 NLCGVMFASIPNFQDFYSEDIDNGKACIRILNEIICDFDELLEEPRFASVEKIKTVGATYMAAAG 1451
            ::.|  |.:|    ...||.|:    .:.:||::...||.::   ....|.|::|:|..||.|:|
Zfish   923 DIVG--FTTI----SALSEPIE----VVDLLNDLYTHFDGII---AIHDVYKVETIGDAYMVASG 974

  Fly  1452 L-NHEHLRLRGETSEDSVCDLVEFAFAMKQK-LEEINGDAFNNFQLRVGICSGPLVSGVIGARKP 1514
            : |....|...|.:..|: |::......|.: :.::      ..::|:|:.|||:|:||:|.:.|
Zfish   975 VPNRNGTRHAAEMANMSL-DILHCIGTFKMRHMPDV------KVKIRIGLHSGPVVAGVVGLKMP 1032

  Fly  1515 VYDIWGNTVNVASRMDSTGENWRVQVPENTAELLCS--RGYTCVKRGEIAVKGKGMMTTFY-VHP 1576
            .|.::|:|||.||||:|||..:|:.|.::|.::|.|  .||....||...:||||:..||: |..
Zfish  1033 RYCLFGDTVNTASRMESTGLPYRIHVNQSTVDVLNSLKLGYKIDTRGRTELKGKGVEETFWLVGR 1097

  Fly  1577 KGISESQLISPVRMPA----GIPLAQTPNLQRQ 1605
            .|..:...|.|...|.    ||.|.:.|..:||
Zfish  1098 DGFDKPLPIPPDLTPGASNHGISLDEIPTDRRQ 1130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 62/209 (30%)
Guanylate_cyc 1381..1576 CDD:278633 62/199 (31%)
gucy2dXP_005165318.1 PBP1_sensory_GC_DEF_like 78..470 CDD:107366
PK_GC-2D 581..849 CDD:270945
HNOBA <858..903 CDD:311573 12/44 (27%)
CYCc 883..1075 CDD:214485 63/211 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.