DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and Npr2

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:NP_446290.1 Gene:Npr2 / 116564 RGDID:620851 Length:1047 Species:Rattus norvegicus


Alignment Length:233 Identity:70/233 - (30%)
Similarity:117/233 - (50%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 QRLAFIETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPM 571
            ::|....|...:|.|:::|       .||..|||:.|..|::    :|  .||:.:       ..
  Rat   813 EKLVEERTQAYLEEKRKAE-------ALLYQILPHSVAEQLK----RG--ETVQAE-------AF 857

  Fly   572 DNVSILFADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVSQFESDN 636
            |:|:|.|:||.|||.|:::::..|:|.:||||:..||.|.::....:|:.:||.|..||.....|
  Rat   858 DSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRN 922

  Fly   637 WKTRPDHAVCSVETGLHMIKAIKDVRL--HTHVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDV 699
            .:.   ||.......|.::.|:...|:  ..|..|.:|||:|:|.|..||:|.|...:.::.:.|
  Rat   923 GQR---HAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTV 984

  Fly   700 IIANHMESGGIPGRVHISEATLKCLNDAYEVEPGNGGC 737
            ..|:.|||.|...::|:|..|...|::.        ||
  Rat   985 NTASRMESNGQALKIHVSSTTKDALDEL--------GC 1014

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 12/43 (28%)
CYCc 526..729 CDD:214485 63/204 (31%)
Guanylate_cyc 566..753 CDD:278633 55/174 (32%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
Npr2NP_446290.1 PBP1_NPR_B 26..421 CDD:380607
PK_GC-A_B 518..792 CDD:270944
HNOBA <798..846 CDD:400168 11/39 (28%)
CYCc 825..1009 CDD:214485 65/206 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.