DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gucy1b1

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:XP_004911214.1 Gene:gucy1b1 / 100379900 XenbaseID:XB-GENE-950986 Length:618 Species:Xenopus tropicalis


Alignment Length:422 Identity:112/422 - (26%)
Similarity:190/422 - (45%) Gaps:91/422 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1184 DEFVRSTLNALTLNLTPPLPQSH----------RPYTLTTNGHSVSLSNLSYSDASVMQSSS--- 1235
            |.||....||: ..:.|.|...:          ||: :..:.|.: ||::  :...|::|..   
 Frog   226 DLFVTQCGNAI-YRVLPQLQPGNCNLLSVFSLVRPH-IDISFHGI-LSHI--NTVFVLRSKEGLL 285

  Fly  1236 DVEGQCAHPEYLVFTWVLCLVSLATALK--LYYLVKALMALAMVAFYTTLIMMKFGSGDSFSLVE 1298
            |||...:..| |..|.:.||     .||  :.||.:|...|.:.            |....:|.:
 Frog   286 DVEKSESEDE-LTGTEISCL-----RLKGQMIYLPEADNILFLC------------SPSVMNLDD 332

  Fly  1299 LSRLGMPLGVQMLILLISFLVMVCYHAR-LVEVTSRLDFIWKEQAERELTNMKSNRALNDTLIKN 1362
            |:|.|:.|....|......||::....| ..::|..|: |..::.:..|..::..:...|||:.:
 Frog   333 LTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELE-ILTDRLQHTLRALEDEKKKTDTLLYS 396

  Fly  1363 ILPDHVATYYLSDEHTDELYSKMHNLCGVMFASIPNFQDFYSEDIDNGKACIRI---LNEIICDF 1424
            :||..||...   .|...:.:|.::...::|:.|..|..|.|:.. :|:..::|   ||:|...|
 Frog   397 VLPPSVANEL---RHKRPVPAKRYDNVTILFSGIVGFNTFCSKHA-SGEGAMKIVNLLNDIYTRF 457

  Fly  1425 DELLEEPRFASVEKIKTVGATYMAAAGLNH---EHLRLRGETSEDSVC----DLVEFAFAMKQKL 1482
            |.|.:......|.|::|||..||..:|:..   .|.|        |:|    |::|.|..:    
 Frog   458 DILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHAR--------SICHLALDMMEIAGQV---- 510

  Fly  1483 EEINGDAFNNFQLRVGICSGPLVSGVIGARKPVYDIWGNTVNVASRMDSTGENWRVQVPENTAEL 1547
             :::|:   :.|:.:||.:|.:|:||||.|.|.|.::|||||:.||.::|||..::.|.|.|   
 Frog   511 -QVDGE---SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYT--- 568

  Fly  1548 LCSRGYTCVK-------------RGEIAVKGK 1566
                 |.|:.             ||.:::|||
 Frog   569 -----YRCLMSPENSDPQFHLQYRGPVSMKGK 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831
CYCc 526..729 CDD:214485
Guanylate_cyc 566..753 CDD:278633
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485 63/210 (30%)
Guanylate_cyc 1381..1576 CDD:278633 62/209 (30%)
gucy1b1XP_004911214.1 HNOB 2..166 CDD:377902
HNOBA 207..406 CDD:369471 49/203 (24%)
Guanylate_cyc 412..605 CDD:306677 62/209 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.