DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ac78C and gucy1a2

DIOPT Version :9

Sequence 1:NP_001262138.1 Gene:Ac78C / 40333 FlyBaseID:FBgn0024150 Length:1727 Species:Drosophila melanogaster
Sequence 2:XP_009290254.2 Gene:gucy1a2 / 100330875 ZFINID:ZDB-GENE-121023-3 Length:608 Species:Danio rerio


Alignment Length:219 Identity:65/219 - (29%)
Similarity:113/219 - (51%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 ETHKAMEHKKESEKELQRTQKLLDSILPNIVNNQIRSEMYKGTDPTVETQFNKLYVYPMDNVSIL 577
            :||:|:|.:|      :||..||.||.|    ..:...:::|. |....:|        |:|::|
Zfish   353 KTHQALEEEK------RRTVDLLYSIFP----GDVAQRLWQGL-PVQAKKF--------DDVTML 398

  Fly   578 FADIKGFTELASKTSAQQLVKILNDLFARFDRIAEDNHCLRVKLLGDCYYCVS-----QFESDNW 637
            |:||.|||.:.::.:..|::.:||:|:.|||.........:::.:||. |||:     :.:|   
Zfish   399 FSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDA-YCVAGGLHRKIDS--- 459

  Fly   638 KTRPDHAVCSVETGLHMIKAIKDVRLHTHVDLNMRIGIHSGSVMCGVLGNKKWHFDVWSNDVIIA 702
                 ||.......|.|::..::|.......:.:|||||||||:.||:|.....:.::.|:|.:|
Zfish   460 -----HAKPIALMALKMMELSEEVLTPDGKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLA 519

  Fly   703 NHMESGGIPGRVHISEATLKCLND 726
            :..|||..|..:::|..|.:.|.|
Zfish   520 SKFESGSHPRCINVSPTTYQLLRD 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ac78CNP_001262138.1 AC_N <288..551 CDD:292831 12/37 (32%)
CYCc 526..729 CDD:214485 60/206 (29%)
Guanylate_cyc 566..753 CDD:278633 50/166 (30%)
DUF1053 929..1020 CDD:283888
CYCc 1353..1554 CDD:214485
Guanylate_cyc 1381..1576 CDD:278633
gucy1a2XP_009290254.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.