DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and ERJ5

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_116699.3 Gene:ERJ5 / 850602 SGDID:S000001937 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:400 Identity:69/400 - (17%)
Similarity:124/400 - (31%) Gaps:167/400 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EVDISYLKS-LDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDK----RKAKGEE 117
            |.:|..|:: :..|...|.:.|..|.|.||: .:|..::.:..|::...:||||    ||     
Yeast    25 ETEIFQLQNEISTKYGPDMNFYKFLKLPKLQ-NSSTKEITKNLRKLSKKYHPDKNPKYRK----- 83

  Fly   118 VIQDDDYFTCITKAYEILGTSKPRRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEK 182
                  .:..:..|.:||..|..|:.:|                          ::..||     
Yeast    84 ------LYERLNLATQILSNSSNRKIYD--------------------------YYLQNG----- 111

  Fly   183 PHVPSFGQVDAKREEVERFYNFWYDF------------KSWREFSYLDEEDKEKGQDRDERRWIE 235
                              |.|  |||            |:|...:::               ||.
Yeast   112 ------------------FPN--YDFHKGGFYFSRMKPKTWFLLAFI---------------WIV 141

  Fly   236 KE--NRAARIKRKKEEMSRIRSLVDLAYNND-------KRIQRFKQEEKDRKAAAKRAKMDAAQA 291
            ..  .....|.:.:.:.|||.:.:......|       |:: .|||.|||.   .|...:..:..
Yeast   142 VNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVKQL-TFKQHEKDE---GKSLVVRFSDV 202

  Fly   292 QKAEADRAIREAALAKEKAEKAEQKRIEQIRIEREQQKKLLKKERKTLRDKVKDCKYYAKNDKDQ 356
            ...|.|.:  |..::.:..:|                            ..||:|.::       
Yeast   203 YVVEPDGS--ETLISPDTLDK----------------------------PSVKNCLFW------- 230

  Fly   357 LKHMEGTEKI-CETFNLAELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKLASSA 420
                    :| ...:|:    ...|::.|.|:|..:    |..:|.     :.|||:........
Yeast   231 --------RIPASVWNM----TFGKSVGSAGKEEII----TDSKKY-----DGNQTKKGNKVKKG 274

  Fly   421 ATPKGVKEVK 430
            :..||.|:::
Yeast   275 SAKKGQKKME 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 42/230 (18%)
DnaJ 76..145 CDD:278647 18/72 (25%)
RILP-like 268..>344 CDD:304877 11/75 (15%)
RAC_head 332..401 CDD:293322 10/69 (14%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
ERJ5NP_116699.3 CbpA 41..271 CDD:225124 62/369 (17%)
DnaJ 44..105 CDD:395170 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.