DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and RL6

DIOPT Version :10

Sequence 1:NP_649284.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_177661.1 Gene:RL6 / 843862 AraportID:AT1G75250 Length:126 Species:Arabidopsis thaliana


Alignment Length:52 Identity:17/52 - (32%)
Similarity:28/52 - (53%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 WTKEEQALLEQAIKTYPTTTPDRWDCIAACIPNRSKKDCLRRVKELVE-LVN 636
            ||..:..:.|:|:..|...|||||..:|..:..::.::..|....||| |:|
plant    12 WTFSQNKMFERALAVYDKDTPDRWHNVAKAVGGKTVEEVKRHYDILVEDLIN 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_649284.1 ZUO1 56..354 CDD:227594
RAC_head 328..407 CDD:435537
SANT 585..632 CDD:238096 12/45 (27%)
RL6NP_177661.1 SANT 11..54 CDD:238096 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.