DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and maMYB

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001331471.1 Gene:maMYB / 834578 AraportID:AT5G45420 Length:309 Species:Arabidopsis thaliana


Alignment Length:236 Identity:55/236 - (23%)
Similarity:87/236 - (36%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 NQTQAKKLASSAATPKGVKEVKKNEL--WSNENVQLLIKAVNLFPAGTAQRWDVIATFINQHSPD 471
            |.:...:::.....|:..:....||.  |:.|.:::|.|.:...|||...||:.:|:........
plant   132 NASAVTEVSRKVVIPQSKESGSVNETKDWTAEEIEILKKQLIKHPAGKPGRWETVASAFGGRYKT 196

  Fly   472 NTVLVNARDVLNKAKALQNTDHSKSSLKTQANDAAFASFEKSKKDVQTCKDITLGEETAQASKEN 536
            ..|:..|:::..| |..::.|              :|.|.|::|                ||...
plant   197 ENVIKKAKEIGEK-KIYESDD--------------YAQFLKNRK----------------ASDPR 230

  Fly   537 LKQNGVDHKANNQSTKQNGTAPAPANPTAAPAPVPATNGSTGGGAASKT---WTKEEQALLEQAI 598
            |    ||....|                           |..||.|..|   |:..|...|..|:
plant   231 L----VDENEEN---------------------------SGAGGDAEGTKEIWSNGEDIALLNAL 264

  Fly   599 KTYPTTTPDRWDCIAACIPNRSKKDCLRRVKELVELVNSKK 639
            |.:|.....||:.|||.:|.:||..|::||.||.:...|.|
plant   265 KAFPKEAAMRWEKIAAAVPGKSKAACMKRVTELKKGFRSSK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124
DnaJ 76..145 CDD:278647
RILP-like 268..>344 CDD:304877
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842 20/51 (39%)
SANT 585..632 CDD:238096 19/49 (39%)
maMYBNP_001331471.1 SANT 160..>193 CDD:238096 10/32 (31%)
SANT 252..298 CDD:238096 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392575at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR43999
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.