DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and AT2G38090

DIOPT Version :10

Sequence 1:NP_649284.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_181344.2 Gene:AT2G38090 / 818387 AraportID:AT2G38090 Length:298 Species:Arabidopsis thaliana


Alignment Length:51 Identity:20/51 - (39%)
Similarity:30/51 - (58%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   586 WTKEEQALLEQAIKTYPTTTPDRWDCIAACIPNRSKKDCLRRVKELVELVN 636
            ||.||....|.|:..|...|||||..:||.:|.::..|.:::.:||.|.|:
plant    29 WTAEENKKFENALAFYDKDTPDRWSRVAAMLPGKTVGDVIKQYRELEEDVS 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_649284.1 ZUO1 56..354 CDD:227594
RAC_head 328..407 CDD:435537
SANT 585..632 CDD:238096 17/45 (38%)
AT2G38090NP_181344.2 SANT 28..74 CDD:238096 16/44 (36%)
myb_SHAQKYF 138..190 CDD:130620
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.