powered by:
Protein Alignment CG10565 and dnajc12
DIOPT Version :9
Sequence 1: | NP_001246856.1 |
Gene: | CG10565 / 40332 |
FlyBaseID: | FBgn0037051 |
Length: | 646 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001314717.1 |
Gene: | dnajc12 / 797196 |
ZFINID: | ZDB-GENE-070801-3 |
Length: | 165 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 20/71 - (28%) |
Similarity: | 36/71 - (50%) |
Gaps: | 7/71 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 QDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSK 139
:|:|.:||..:| ::.:.:...::...|..||||.....:.|.| |..:.:|.|:|...|
Zfish 13 EDYYGLLGCDEL---STTEQIVNEFKVKALACHPDKHPENPKAVEQ----FQKLQEAKEVLTDEK 70
Fly 140 PRRSFD 145
.|:|:|
Zfish 71 KRKSYD 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170592369 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.