DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and dnajc12

DIOPT Version :10

Sequence 1:NP_649284.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001314717.1 Gene:dnajc12 / 797196 ZFINID:ZDB-GENE-070801-3 Length:165 Species:Danio rerio


Alignment Length:71 Identity:20/71 - (28%)
Similarity:36/71 - (50%) Gaps:7/71 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSK 139
            :|:|.:||..:|   ::.:.:...::...|..||||.....:.|.|    |..:.:|.|:|...|
Zfish    13 EDYYGLLGCDEL---STTEQIVNEFKVKALACHPDKHPENPKAVEQ----FQKLQEAKEVLTDEK 70

  Fly   140 PRRSFD 145
            .|:|:|
Zfish    71 KRKSYD 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_649284.1 ZUO1 56..354 CDD:227594 20/71 (28%)
RAC_head 328..407 CDD:435537
SANT 585..632 CDD:238096
dnajc12NP_001314717.1 DnaJ 14..76 CDD:395170 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.