DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and Dnajc21

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_084322.2 Gene:Dnajc21 / 78244 MGIID:1925371 Length:531 Species:Mus musculus


Alignment Length:551 Identity:128/551 - (23%)
Similarity:220/551 - (39%) Gaps:139/551 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPR 141
            ||..||   :|.:|||:::::|||::.|..||||......|..:.   |..|..||::|...:.|
Mouse     4 HYEALG---VRRDASEEELKKAYRKLALRWHPDKNLDNAAEAAEQ---FKLIQAAYDVLSDPQER 62

  Fly   142 RSFDS---------VDPEF-DDSL-----------PSQNDIDNDYFGVFNKFFTLNGR------- 178
            ..:|:         :|.|: ||||           ....|.:..::.|:...|.|..:       
Mouse    63 AWYDNHREALLKGGLDGEYQDDSLDLLHYFTVTCYSGYGDDERGFYAVYRVVFELIAKEELECMS 127

  Fly   179 WSEKPHVPSFGQVDAKREE-VERFYNFWYDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAAR 242
            ..:....|:||...:..:. |..||..|..|.:.:.||:.:|.|..:..:|.|:|.:||||:..|
Mouse   128 EGDVEDFPTFGDSQSDYDTVVHPFYAHWQSFCTQKNFSWKEEYDTRQASNRWEKRAMEKENKKIR 192

  Fly   243 IKRKKEEMSRIRSLVDLAYNNDKRIQRFKQ------EEKDRKAAAKRAKMDAAQAQKAE------ 295
            .:.:||:...:|.||......|||:|..::      .||.|||...|.:....||:.||      
Mouse   193 DRARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNAEKARKAEEMRRQQKLKQAKLAEQYREQS 257

  Fly   296 ------ADRAIREAALAKEK------------------------AEKAEQKRIEQ--------IR 322
                  .::.::|.....||                        :|:||:..:.|        ..
Mouse   258 WMTMANLEKELQEMEARYEKEFGDGSDENEVEDQEPRNGLDGKDSEEAEEAELYQDLYCPACDKS 322

  Fly   323 IEREQQKKLLKKERKTLRDKVKDCKYYAKNDKDQLKHMEGTEKICETFNLAEL-----QALNKAM 382
            .:.|:..|..:|.:|. |:.|...|...:.:::|...::..|.:....:..|:     |.|:|..
Mouse   323 FKTEKAMKNHEKSKKH-REMVALLKQQLEEEEEQFSGVQMDENVLNANSEEEMEDTPKQKLSKKQ 386

  Fly   383 ESKGRESFVAALQTAEQ-----------KIAAELEEINQTQAKKL-------------ASSAATP 423
            :.|.::|    .|..:.           |||.|..:.|:..||:|             ..:...|
Mouse   387 KKKKQKS----AQNFDDNFNENGTEEGGKIAPEKTKSNEDNAKELENRPQENTCITETTEACEDP 447

  Fly   424 KG-VKEVKKNELWSNENVQLLIKAVNLFPAGTAQRWDVIATFINQHS--PDNTVLVNARDVLNKA 485
            |. .|.|.|::....::|:..:||    ||......||:.:....||  |....|.:        
Mouse   448 KSEAKSVPKSKGKKTKDVKKSVKA----PAEAQPVSDVLISCATCHSEFPSRNKLFD-------- 500

  Fly   486 KALQNTDHSKSSLKTQANDAAFASFEKSKKD 516
             .|:.|.|:::...|    |:..|..::||:
Mouse   501 -HLKATGHARAPSAT----ASLNSVTRNKKE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 68/239 (28%)
DnaJ 76..145 CDD:278647 23/67 (34%)
RILP-like 268..>344 CDD:304877 23/125 (18%)
RAC_head 332..401 CDD:293322 14/84 (17%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
Dnajc21NP_084322.2 DnaJ 3..66 CDD:278647 23/67 (34%)
DBINO <181..243 CDD:290603 21/61 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..309 3/30 (10%)
zf-C2H2_jaz 314..339 CDD:288983 4/25 (16%)
C2H2 Zn finger 316..338 CDD:275371 3/21 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..480 33/161 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..531 6/24 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847148
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.