Sequence 1: | NP_001246856.1 | Gene: | CG10565 / 40332 | FlyBaseID: | FBgn0037051 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083945.1 | Gene: | Dnajc18 / 76594 | MGIID: | 1923844 | Length: | 357 | Species: | Mus musculus |
Alignment Length: | 336 | Identity: | 74/336 - (22%) |
---|---|---|---|
Similarity: | 123/336 - (36%) | Gaps: | 123/336 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 QRRQFLAPGGVERSESDEKLEGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRR 97
Fly 98 AYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSV-DPEFDDSLPS---- 157
Fly 158 ------QNDIDNDYFGVFNKFFTLNGRWSEKPHVPS-----FGQV--DA---------------K 194
Fly 195 REE----------------------------------VERFYNFWYDFKSWREFS------YLDE 219
Fly 220 E-DKE-KGQD-RDERRWIEK------ENRAARIKRKKEEMSRIRSLVDLAYNNDKRIQRFKQEEK 275
Fly 276 DRKAAAKRAKM 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10565 | NP_001246856.1 | CbpA | 76..282 | CDD:225124 | 61/287 (21%) |
DnaJ | 76..145 | CDD:278647 | 19/68 (28%) | ||
RILP-like | 268..>344 | CDD:304877 | 6/19 (32%) | ||
RAC_head | 332..401 | CDD:293322 | |||
SANT | 584..633 | CDD:197842 | |||
SANT | 585..632 | CDD:238096 | |||
Dnajc18 | NP_083945.1 | PRK14298 | 81..>182 | CDD:184612 | 28/112 (25%) |
DUF1977 | 250..349 | CDD:370429 | 24/104 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167847135 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |