DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and Dnajc18

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_083945.1 Gene:Dnajc18 / 76594 MGIID:1923844 Length:357 Species:Mus musculus


Alignment Length:336 Identity:74/336 - (22%)
Similarity:123/336 - (36%) Gaps:123/336 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QRRQFLAPGGVERSESDEKLEGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRR 97
            |.||    |....:.::|:|.||      ..:|       |.:::|.:||:.   :.||::::::
Mouse    56 QTRQ----GEGNATYTEEQLRGV------QRIK-------KCRNYYDILGVS---HNASDEELKK 100

  Fly    98 AYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSV-DPEFDDSLPS---- 157
            ||:::.|..||||..|.|.     .:.|..|..|:.:|.....|..:|.. |.:...::|.    
Mouse   101 AYKKLALKFHPDKNCAPGA-----TEAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTVPRARSY 160

  Fly   158 ------QNDIDNDYFGVFNKFFTLNGRWSEKPHVPS-----FGQV--DA---------------K 194
                  :.||..:  .:||.||  .|      |.||     |..|  |:               |
Mouse   161 HYYKDFEADISPE--ELFNVFF--GG------HFPSGNIHMFSNVTDDSQYYRRRHRHERTQTHK 215

  Fly   195 REE----------------------------------VERFYNFWYDFKSWREFS------YLDE 219
            |||                                  ...||.....:...||..      ::|:
Mouse   216 REEDKSQTPYSAFVQLLPVLVIVTISVITQLLAANPPYSLFYKSTLGYTISRETQNLQVPYFVDK 280

  Fly   220 E-DKE-KGQD-RDERRWIEK------ENRAARIKRKKEEMSRIRSLVDLAYNNDKRIQRFKQEEK 275
            . ||. :|.. ||..:.|||      :....:.|::|.|::.:..|.     .|:|: |.|.|..
Mouse   281 NFDKAYRGASLRDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLY-----RDERL-RQKAESL 339

  Fly   276 DRKAAAKRAKM 286
            ..:..||.:|:
Mouse   340 KLENCAKLSKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 61/287 (21%)
DnaJ 76..145 CDD:278647 19/68 (28%)
RILP-like 268..>344 CDD:304877 6/19 (32%)
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
Dnajc18NP_083945.1 PRK14298 81..>182 CDD:184612 28/112 (25%)
DUF1977 250..349 CDD:370429 24/104 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.