DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10565 and Dnajc3

DIOPT Version :9

Sequence 1:	NP_001246856.1	Gene:	CG10565 / 40332	FlyBaseID:	FBgn0037051	Length:	646	Species:	Drosophila melanogaster
Sequence 2:	NP_071568.1	Gene:	Dnajc3 / 63880	RGDID:	708518	Length:	504	Species:	Rattus norvegicus

Alignment Length:	110	Identity:	30/110 - (27%)
Similarity:	60/110 - (54%)	Gaps:	12/110 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 ERSESDEKL-EGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHH 107
            |::|:|::: ||:.:...:.       |:.:.:|:|.:||   ::..|.:.::.:|||::.|..|
  Rat   368 EQNENDQQIREGLEKAQRLL-------KQSQKRDYYKILG---VKRNAKKQEIIKAYRKLALQWH 422

  Fly   108 PDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSVDPEFD 152
            ||..::: ||..:.:..|..|..|.|:|...:.||.||..:...|
  Rat   423 PDNFQSE-EEKKKAEKKFIDIAAAKEVLSDPEMRRKFDDGEDPLD 466

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10565	NP_001246856.1	CbpA	76..282	CDD:225124	24/77 (31%)
		DnaJ	76..145	CDD:278647	21/68 (31%)
		RILP-like	268..>344	CDD:304877
		RAC_head	332..401	CDD:293322
		SANT	584..633	CDD:197842
		SANT	585..632	CDD:238096
Dnajc3	NP_071568.1	TPR_11	36..100	CDD:290150
		TPR 1	37..70
		TPR repeat	37..65	CDD:276809
		TPR repeat	70..100	CDD:276809
		TPR 2	72..104
		TPR_11	73..136	CDD:290150
		TPR 3	105..138
		TPR repeat	105..133	CDD:276809
		TPR_1	107..137	CDD:278916
		TPR_11	153..217	CDD:290150
		TPR 4	154..187
		TPR repeat	157..182	CDD:276809
		TPR_11	187..252	CDD:290150
		TPR repeat	187..217	CDD:276809
		TPR 5	188..221
		TPR 6	222..255
		TPR repeat	222..250	CDD:276809
		TPR repeat	256..296	CDD:276809
		TPR 7	268..301
		TPR repeat	301..335	CDD:276809
		TPR 8	306..339
		TPR 9	340..373		2/4 (50%)
		TPR repeat	340..368	CDD:276809	30/110 (27%)
		TPR repeat	374..397	CDD:276809	4/29 (14%)
		Flexible linker. /evidence=ECO:0000250	375..393		3/24 (13%)
		DnaJ	392..>498	CDD:223560	24/79 (30%)
		DnaJ	394..459	CDD:278647	21/68 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	451..481		5/16 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166350654
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930