DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and dnajc3b

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_571705.1 Gene:dnajc3b / 58154 ZFINID:ZDB-GENE-000831-4 Length:502 Species:Danio rerio


Alignment Length:505 Identity:111/505 - (21%)
Similarity:167/505 - (33%) Gaps:186/505 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATAVEVQLPLKVVRRKIERVG--------------------FAYFAQRRQFLAPGGVERSESDEK 51
            ||.||::..|: :.||:...|                    ..|:.:...|||.|     :|...
Zfish    37 ATPVEIEHHLE-MGRKLLAAGQLAEALSHYHSAVEGDSKSYLTYYKRATVFLAMG-----KSKSA 95

  Fly    52 LEGVGEEVDIS-------------YLK-----------------SLDPKEWKDQDHYAVLGLGKL 86
            |..:.:.:.:.             .||                 |.|.||..||    :|...||
Zfish    96 LPDLTQAIQLKPDFLAARLQRGNILLKQGSTQEAREDFQAVLNHSPDHKEAHDQ----LLKADKL 156

  Fly    87 RYEASEDDVRRAYRR-------MVLLH-------HPDKRKAKGEEVIQDDDYFTCITKAYEILGT 137
              |:.:::|..|:||       .||.|       .|:.|:.:.|..||              || 
Zfish   157 --ESLQEEVHEAHRRGDCRIAVQVLEHVIELSPWDPESRELRAECYIQ--------------LG- 204

  Fly   138 SKPRRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFY 202
             :||::...:.|      .|:...||.  ..|.|...|:  :|...|..|..||           
Zfish   205 -EPRKAIMDLTP------ASRLRADNR--AAFLKLSQLH--YSLGEHHDSLNQV----------- 247

  Fly   203 NFWYDFKSWREFSYLDEEDKE----------KGQDRDERRWIEKENRAARIKRKKEEMSRIRSLV 257
                     ||...||::|||          ..:..|....:..|.|......|.|.:.|....|
Zfish   248 ---------RECLKLDQDDKECFALYKQVKKLSKQLDSAEELISEQRFQEAIEKYESVMRTEPNV 303

  Fly   258 DLAYNNDKRIQRFKQEEKD-----RKAAAKRAKMDAAQAQKAE-------ADRAIREAALAKEKA 310
            .. |.|       |.:|:.     :..:|:.|....::|.:.|       .|||  ||.:..::.
Zfish   304 AF-YTN-------KAKERTCFCLVKMKSAEEAVDICSEAHQREPQNIHILRDRA--EAYILMQEY 358

  Fly   311 EKAEQKRIEQIRIEREQQK---------KLLKKERKTLRDKVKDCKYYAKNDKDQLKHMEGTEKI 366
            |||.:...|....::|.|:         ||||..||  ||      ||               ||
Zfish   359 EKAVEDYQEAREFDQENQELREGLDRAHKLLKISRK--RD------YY---------------KI 400

  Fly   367 CETFNLAELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKL 416
            ......|..|.:.||.....::......|:...|..||.:.|:...||::
Zfish   401 LGVSRSANKQEIIKAYRKLAQQWHPDNFQSEADKKEAEKKFIDIASAKEV 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 50/234 (21%)
DnaJ 76..145 CDD:278647 20/82 (24%)
RILP-like 268..>344 CDD:304877 25/96 (26%)
RAC_head 332..401 CDD:293322 15/68 (22%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
dnajc3bNP_571705.1 TPR_11 41..107 CDD:290150 12/71 (17%)
TPR repeat 42..70 CDD:276809 4/28 (14%)
TPR repeat 75..105 CDD:276809 7/34 (21%)
TPR_11 77..141 CDD:290150 9/68 (13%)
TPR repeat 110..137 CDD:276809 2/26 (8%)
TPR repeat 157..184 CDD:276809 8/26 (31%)
TPR_11 189..254 CDD:290150 23/110 (21%)
TPR repeat 190..218 CDD:276809 10/49 (20%)
TPR repeat 223..253 CDD:276809 11/53 (21%)
TPR repeat 303..337 CDD:276809 8/41 (20%)
TPR repeat 342..370 CDD:276809 9/29 (31%)
TPR 348..375 CDD:197478 8/28 (29%)
DnaJ 394..>500 CDD:223560 18/80 (23%)
DnaJ 396..461 CDD:278647 16/76 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592370
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.