DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and DNAJC12

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_068572.1 Gene:DNAJC12 / 56521 HGNCID:28908 Length:198 Species:Homo sapiens


Alignment Length:208 Identity:43/208 - (20%)
Similarity:74/208 - (35%) Gaps:63/208 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSK 139
            :|:|.:||..:|   :|.:.:...::...|..||||.....:.|    :.|..:.||.|||...:
Human    13 EDYYTLLGCDEL---SSVEQILAEFKVRALECHPDKHPENPKAV----ETFQKLQKAKEILTNEE 70

  Fly   140 PRRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYNF 204
            .|..:|.. .....|:|            |.::..||.......|....|:.|...||.::.:. 
Human    71 SRARYDHW-RRSQMSMP------------FQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHT- 121

  Fly   205 WYDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRKKEEMSRIRSLVDLAYNNDKRIQR 269
                            .|.:.::.:|:|           :|||||::....              
Human   122 ----------------TKMENEECNEQR-----------ERKKEELASTAE-------------- 145

  Fly   270 FKQEEKDRKAAAK 282
             |.|:|:.|...|
Human   146 -KTEQKEPKPLEK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 42/205 (20%)
DnaJ 76..145 CDD:278647 19/68 (28%)
RILP-like 268..>344 CDD:304877 5/15 (33%)
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
DNAJC12NP_068572.1 CbpA 9..>164 CDD:225124 43/208 (21%)
DnaJ 14..76 CDD:306689 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..169 15/87 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156739
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.