DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10565 and dnajc16l

DIOPT Version :9

Sequence 1:	NP_001246856.1	Gene:	CG10565 / 40332	FlyBaseID:	FBgn0037051	Length:	646	Species:	Drosophila melanogaster
Sequence 2:	XP_021335369.1	Gene:	dnajc16l / 556590	ZFINID:	ZDB-GENE-130530-696	Length:	789	Species:	Danio rerio

Alignment Length:	144	Identity:	37/144 - (25%)
Similarity:	56/144 - (38%)	Gaps:	53/144 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    76 DHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKP 140
            |.|:|||:.|   .||..::::.|:::....||||.|:.|.|     |.|..|||:||||...:.
Zfish    36 DPYSVLGVSK---HASLTEIKKMYKKLAREWHPDKNKSPGAE-----DMFIKITKSYEILSNEER 92

  Fly   141 RRSFDSVDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYNFW 205
            |.::|                                         .|||:|    |.:.|....
Zfish    93 RANYD-----------------------------------------RFGQMD----ENQNFARPP 112

  Fly   206 YDFKSWREFSYLDE 219
            ..|:.:.:..|.||
Zfish   113 QGFRQYHDSFYFDE 126

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10565	NP_001246856.1	CbpA	76..282	CDD:225124	37/144 (26%)
		DnaJ	76..145	CDD:278647	26/68 (38%)
		RILP-like	268..>344	CDD:304877
		RAC_head	332..401	CDD:293322
		SANT	584..633	CDD:197842
		SANT	585..632	CDD:238096
dnajc16l	XP_021335369.1	DnaJ	36..>136	CDD:333066	37/144 (26%)
dnajc16l	XP_021335369.1	TRX_DnaJ	137..246	CDD:239261
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170592377
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930