Sequence 1: | NP_001246856.1 | Gene: | CG10565 / 40332 | FlyBaseID: | FBgn0037051 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002464.1 | Gene: | dnajc5aa / 386768 | ZFINID: | ZDB-GENE-031113-20 | Length: | 202 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 44/196 - (22%) |
---|---|---|---|
Similarity: | 66/196 - (33%) | Gaps: | 78/196 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 YAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRR 142
Fly 143 SFDS-------VDPEFDDSLPSQNDIDNDYFGVFNKFFTLNGRWSE------------------- 181
Fly 182 ----------KPHVPSFGQVDAKREEVERFYNFWYDFKSWREFSYLDEEDKEKGQDRDERRWIEK 236
Fly 237 E 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10565 | NP_001246856.1 | CbpA | 76..282 | CDD:225124 | 44/196 (22%) |
DnaJ | 76..145 | CDD:278647 | 23/66 (35%) | ||
RILP-like | 268..>344 | CDD:304877 | |||
RAC_head | 332..401 | CDD:293322 | |||
SANT | 584..633 | CDD:197842 | |||
SANT | 585..632 | CDD:238096 | |||
dnajc5aa | NP_001002464.1 | DnaJ | 16..>85 | CDD:223560 | 24/73 (33%) |
DnaJ | 16..78 | CDD:278647 | 23/66 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170592367 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |