DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and CG2790

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 / 37992 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster


Alignment Length:561 Identity:122/561 - (21%)
Similarity:208/561 - (37%) Gaps:166/561 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSVDP 149
            :|:..|::.|::.|||:|.|..||||..   :.:.:..:.|..|.:|||:|...:.|..:|:   
  Fly     9 ELQRNANDGDIKSAYRKMALRWHPDKNP---DRLAEAKERFQLIQQAYEVLSDPQERSWYDN--- 67

  Fly   150 EFDDSLPSQN-DIDNDYFGVFNKFFTLN--GRWSEKPH--------------------------- 184
            ..:..|..:| |...:...|| :|||.:  ..:.:..|                           
  Fly    68 HREQILRGKNSDYAENCLDVF-QFFTSSCYKGYGDNEHGFYRVYTDVFVQIASEDLEFMDKDDRL 131

  Fly   185 --VPSFGQVDAKREE-VERFYNFWYDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRK 246
              .|.||..::..|: |..||.||..:.:.:.:.:|...|..:.::|...|.:|||.:......:
  Fly   132 GMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREIKERFILRKVEKEMKKIVQAAR 196

  Fly   247 KEEMSRIRSLVDLAYNNDKRIQ-------------RFKQEEKDRKAAAKRAKMDAAQAQKAEADR 298
            ||....:|:||:.....|.|:|             |.|||||.::...||      |.:.|    
  Fly   197 KERNEEVRNLVNFVRKRDPRVQAYRRMLEERVEANRLKQEEKRKEQLRKR------QEELA---- 251

  Fly   299 AIREAALAKEKAEKAEQKRIEQIRIEREQQKKLLKKERKTLRDKVKD------------------ 345
            |:|:..:..|..|       ||:: :.|||.. .|.|..|..|:..|                  
  Fly   252 AVRKNNVFNEGYE-------EQLK-QLEQQYD-SKSEDYTDEDENDDDGEDFDHEGGQEAEEYEV 307

  Fly   346 ----------CKYYAKNDK------DQLKHMEGTEKICETFNLAELQALNKAMESK--GRESFVA 392
                      |....||.|      :..||.|..:::|:.....|....|:..|..  |.:..:.
  Fly   308 EYVDDLYCVACNKTFKNAKARANHEESKKHNENVDRLCQEMEEEEDAFHNEPHEDSLMGVQESLE 372

  Fly   393 ALQTAEQKIAAELEEINQTQAKKLASSAATPKGVKEVKKNELWSNENVQLLIKAVNLFPAGTAQR 457
            .||.:|.:|:  .:.:...:...||         |..|||:......|:          ...|:.
  Fly   373 ELQVSEDQIS--FDGVPSEEESSLA---------KRTKKNKKARKSAVK----------QAQAEG 416

  Fly   458 WDVIATFINQHSPDNTVLVNARDVLNKAKALQNTDHSKSSLKTQANDAAFA----SFEKSKKDVQ 518
            .|         .||..:                   .|.::|:::.|..::    :.:|||....
  Fly   417 SD---------EPDEPI-------------------EKKAIKSESEDEDWSKGKKASKKSKSKKT 453

  Fly   519 TCKDITLGEETAQASKENLKQNGVDHKANNQS---TKQNGT 556
            |.:.:.|.|:|  .|:.|.|:..|..|:.::.   ||...|
  Fly   454 TTRKVKLLEQT--VSEPNTKEATVAPKSGDEDLDPTKSQHT 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 59/242 (24%)
DnaJ 76..145 CDD:278647 19/59 (32%)
RILP-like 268..>344 CDD:304877 24/88 (27%)
RAC_head 332..401 CDD:293322 20/104 (19%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 19/59 (32%)
ZUO1 19..>252 CDD:227594 60/249 (24%)
zf-C2H2_jaz 313..337 CDD:288983 4/23 (17%)
C2H2 Zn finger 315..337 CDD:275371 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.