DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and Dnajc5g

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_017449734.1 Gene:Dnajc5g / 366567 RGDID:1307426 Length:186 Species:Rattus norvegicus


Alignment Length:104 Identity:27/104 - (25%)
Similarity:47/104 - (45%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRR 142
            ||||   :|:..|..:::::|||::.|.:||||.....    |..::|..|..|:.:|.....::
  Rat    19 YAVL---ELKKGAQPEEIKKAYRKLALQYHPDKNPGNS----QAAEFFKDINAAHAVLTDPTKKK 76

  Fly   143 SFDSVDPEFDDSLPSQNDIDNDYFGV--FNKFFTLNGRW 179
            .:|...        |......|:||.  ...:|.:|..|
  Rat    77 IYDRHG--------SLGLYLYDHFGEEGVRTYFIVNSCW 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 27/104 (26%)
DnaJ 76..145 CDD:278647 19/66 (29%)
RILP-like 268..>344 CDD:304877
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
Dnajc5gXP_017449734.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.