DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and Atac1

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster


Alignment Length:129 Identity:34/129 - (26%)
Similarity:52/129 - (40%) Gaps:26/129 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 EETAQASKENLKQNGVDHKANNQSTKQNG---TAPAPANPTAAP---------APVPAT------ 573
            |.|.....|| .|:.:|...||:....:.   |...|..||.:|         .|..|:      
  Fly    54 EATQNIYLEN-PQHMLDKLRNNEPLIADNYITTTVLPDLPTLSPNDEEGGTNETPTDASSWTQEA 117

  Fly   574 --NGSTGGGAA---SKTWTKEEQALLEQAIKTYPTTTPD--RWDCIAACIPNRSKKDCLRRVKE 630
              |.....|.:   ::.||.|||:.|||.:..||....:  |:..||..:.||:.:....||::
  Fly   118 NKNRDRSNGRSENFNRLWTNEEQSRLEQLLIQYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124
DnaJ 76..145 CDD:278647
RILP-like 268..>344 CDD:304877
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842 17/49 (35%)
SANT 585..632 CDD:238096 17/48 (35%)
Atac1NP_609088.1 SANT 135..185 CDD:197842 17/47 (36%)
SANT 135..183 CDD:238096 17/47 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.