DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and CG7872

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster


Alignment Length:328 Identity:69/328 - (21%)
Similarity:120/328 - (36%) Gaps:90/328 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRR 142
            |.|||:.:   |:|:.::.:|||::...:|||..:. .|.....:..|..:..|||||...:.|.
  Fly    33 YDVLGVTR---ESSKSEIGKAYRQLARRYHPDLHRG-AEAKAAAETQFKLVATAYEILRDEESRT 93

  Fly   143 SFDSVDPEFDDSLPSQNDIDND--YFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYNFW 205
            .:|.:             :||.  |:..:.:::  ..|.:.|..|.....|......|.::|:.|
  Fly    94 DYDYM-------------LDNPDAYYAHYYRYY--RRRVAPKVDVRVVIVVVLTIVSVIQYYSGW 143

  Fly   206 YDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRK-KEEMSRIRSLVDLAYNNDKR--- 266
            ..:.|  ...|.....|.:.|..:    |.::....:|::| |..||:          ||:|   
  Fly   144 QRYDS--AIKYFATVPKYRNQALE----IARDEIQEKIQKKGKNRMSK----------NDQRDEL 192

  Fly   267 ---IQRFKQEEKDRKAA-AKRAKMDAAQAQKAEADRAI--------------------------- 300
               |:|..:|:.|.|.. ||....|....|.......|                           
  Fly   193 ERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFIVWHAQWFWRYTVMKQPYGREQKL 257

  Fly   301 ----REAALAKEKAEKAEQKRIEQ------------IRIEREQQKKLLKKERKTLRDKVKDCKYY 349
                |...:.:.:.|..|.|.||:            :..:.||::::.||..:..|  .|..:.|
  Fly   258 YLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQEEEMKKKLAENPR--YKAYRRY 320

  Fly   350 AKN 352
            .||
  Fly   321 MKN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 49/213 (23%)
DnaJ 76..145 CDD:278647 20/66 (30%)
RILP-like 268..>344 CDD:304877 20/119 (17%)
RAC_head 332..401 CDD:293322 7/21 (33%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.