DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and dnajc3a

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_955904.2 Gene:dnajc3a / 322544 ZFINID:ZDB-GENE-030131-1264 Length:504 Species:Danio rerio


Alignment Length:453 Identity:94/453 - (20%)
Similarity:164/453 - (36%) Gaps:116/453 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GGVERS-ESDEKLEGVGEEVD-ISYLKSL---DPKEWKDQDHYAV--LGLGKLR---------YE 89
            ||||.. |..:||...|:..| :|:..:.   :||.:......|.  |.:||.:         .|
Zfish    35 GGVENHLEMGKKLLAAGQLADALSHFHAAVDGEPKNYMAFYRRATVYLAMGKSKSALPDLSKVIE 99

  Fly    90 ASED-DVRRAYRRMVLLHHP--DKRKAKGEEVI-------QDDDYFTCITKAYEILGTSKPRRSF 144
            ...| ...|..|..:||.|.  |:.::..::|:       ::.:..:.:.|:.||      :|..
Zfish   100 LKPDFTSARLQRGNLLLKHGKLDEAESDFKKVLKSNPSSREEQEAQSQLKKSDEI------QRLV 158

  Fly   145 DSVDPEFD----DSLPSQNDI-------DNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDA----K 194
            .....:|.    .|..|..||       |.|...:..:.|...|...:     :...:.|    |
Zfish   159 SQAQSDFKHREYSSAASHLDIIIDTCVWDVDSREMRAECFIQMGELGK-----AISDLKAASKLK 218

  Fly   195 REEVERFY---NFWYD-------FKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRKKEE 249
            .:..:.||   ..:||       ....||...||::.|:......:.:.:.|:.::|....::|:
Zfish   219 SDNTQAFYKLSTIYYDLGDHEMSLNEVRECLKLDQDHKQCFSHYKQVKKLNKQIQSAEELIQQEK 283

  Fly   250 MSRIRSLVDLAYNNDKRIQRFKQEEKDRKAAAKRAKMDAAQA-------------------QKAE 295
            .|...|..:.....:..:..|....|:|...........|:|                   .:||
Zfish   284 YSDAVSKYESVMKTEPNVPHFTLNAKERMCHCLSKDQQTARAISVCSEVLNTDPQNVNALKDRAE 348

  Fly   296 A-------DRAIREAALAKEKAEKAEQKRIEQIRIEREQQKKLLKKERKTLRDKVKDCKYYAKND 353
            |       :.||::...|||.:|..     .||:...|:.::|||:.:|  ||      ||    
Zfish   349 ALLQDDQYEEAIKDFQSAKEYSEND-----RQIKEGLERAQRLLKQSKK--RD------YY---- 396

  Fly   354 KDQLKHMEGTEKICETFNLAELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKL 416
                       ||......|:.:.:.||.....::......|.||:|..||.:.|:..|||::
Zfish   397 -----------KILGVKRTAQKKEILKAYRKLAQQWHPDNFQDAEEKKKAEKKFIDIAQAKEV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 45/251 (18%)
DnaJ 76..145 CDD:278647 17/89 (19%)
RILP-like 268..>344 CDD:304877 23/101 (23%)
RAC_head 332..401 CDD:293322 15/68 (22%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
dnajc3aNP_955904.2 TPR repeat 37..65 CDD:276809 8/27 (30%)
TPR_11 38..102 CDD:290150 14/63 (22%)
TPR repeat 70..100 CDD:276809 4/29 (14%)
TPR_11 73..136 CDD:290150 13/62 (21%)
TPR_1 73..104 CDD:278916 5/30 (17%)
TPR repeat 105..133 CDD:276809 7/27 (26%)
TPR repeat 157..182 CDD:276809 5/24 (21%)
TPR_11 194..252 CDD:290150 10/62 (16%)
TPR repeat 221..251 CDD:276809 6/29 (21%)
TPR repeat 256..281 CDD:276809 3/24 (13%)
LcrH_SycD 262..389 CDD:274197 24/131 (18%)
TPR repeat 301..335 CDD:276809 5/33 (15%)
TPR repeat 340..368 CDD:276809 6/27 (22%)
TPR repeat 374..397 CDD:276809 11/45 (24%)
DnaJ 391..>502 CDD:223560 20/81 (25%)
DnaJ 394..459 CDD:278647 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.