DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and Dnajc7

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_006247373.1 Gene:Dnajc7 / 303536 RGDID:1303226 Length:579 Species:Rattus norvegicus


Alignment Length:185 Identity:49/185 - (26%)
Similarity:87/185 - (47%) Gaps:26/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 AYFAQRRQFLAPGGVERSESD-EKL---EGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYE 89
            ||..:.:.::.....|.:..| ||:   |...|...:.....|:.|:.|.:|:|.:||:.|   .
  Rat   415 AYLRRAQCYMDTEQFEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDK---N 476

  Fly    90 ASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDD-YFTCITKAYEILGTSKPRRSFDSVDPEFDD 153
            ||||::::|||:..|:||||:......||.:::: .|..:.:|:.||...|.:..:|| ..:.|:
  Rat   477 ASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDS-GQDLDE 540

  Fly   154 SLPSQNDIDNDYFGVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYNFWYDF 208
            ...:..|.|.:  .:|..||...|.:|.:...|.               ||::.|
  Rat   541 EGMNMGDFDAN--NIFKAFFGGPGGFSFEASGPG---------------NFYFQF 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 38/134 (28%)
DnaJ 76..145 CDD:278647 24/69 (35%)
RILP-like 268..>344 CDD:304877
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
Dnajc7XP_006247373.1 AANH_like <19..91 CDD:294206
TPR_11 112..177 CDD:290150
TPR 113..146 CDD:197478
TPR repeat 113..141 CDD:276809
TPR_17 135..167 CDD:290167
TPR repeat 146..176 CDD:276809
TPR repeat 181..209 CDD:276809
TPR repeat 230..255 CDD:276809
TPR repeat 260..290 CDD:276809
TPR 295..328 CDD:197478
TPR repeat 295..323 CDD:276809
TPR_11 342..409 CDD:290150
TPR repeat 342..369 CDD:276809
TPR repeat 374..408 CDD:276809
TPR_11 378..441 CDD:290150 6/25 (24%)
TPR_1 379..412 CDD:278916
TPR repeat 413..441 CDD:276809 6/25 (24%)
DnaJ 465..>554 CDD:223560 29/94 (31%)
DnaJ 466..533 CDD:278647 24/69 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.