DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and DNAJC18

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_689899.1 Gene:DNAJC18 / 202052 HGNCID:28429 Length:358 Species:Homo sapiens


Alignment Length:363 Identity:75/363 - (20%)
Similarity:138/363 - (38%) Gaps:108/363 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FAQRRQFLAPGGVERSESDEKLEGVGEEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDV 95
            :.|.||    |....:.|:|:|.||      ..:|       |.:::|.:||:.:   :||::::
Human    54 WTQTRQ----GEGNSTYSEEQLLGV------QRIK-------KCRNYYEILGVSR---DASDEEL 98

  Fly    96 RRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSKPRRSFDSV-DPEFDDSLPS-- 157
            ::|||::.|..||||..|.|.     .|.|..|..|:.:|.....|..:|.. |.:...:.|.  
Human    99 KKAYRKLALKFHPDKNCAPGA-----TDAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTAPRAR 158

  Fly   158 ----QNDIDNDYF--GVFNKFFTLNGRWSEKPHVPSFGQVDAKREEVERFYN-----FWYDFKSW 211
                ..|.:.|..  .:||.||  .|      |.|:        ..:..|.|     ::|..:..
Human   159 PYNYYRDFEADITPEELFNVFF--GG------HFPT--------GNIHMFSNVTDDTYYYRRRHR 207

  Fly   212 REFSYLDEEDKEKGQDRDERRWIE---------------------------KENRAARIKRKKEE 249
            .|.:...:|::|:........:|:                           |......|.|:.:.
Human   208 HERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQN 272

  Fly   250 MSRIRSLVDLAYNNDKRIQRFKQEEKDRKAAAKRAKMDAAQAQKAEADRAIREAALAKEKAEKAE 314
            : ::...||..::...|.......||    ..::..:|..|            .:..|||.:|:|
Human   273 L-QVPYFVDKNFDKAYRGASLHDLEK----TIEKDYIDYIQ------------TSCWKEKQQKSE 320

  Fly   315 QKRIEQI-RIEREQQKKLLKKERKTLRDKVKDCKYYAK 351
            ...:..: |.||      ||::.::|  |:::|:..:|
Human   321 LTNLAGLYRDER------LKQKAESL--KLENCEKLSK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 48/246 (20%)
DnaJ 76..145 CDD:278647 21/68 (31%)
RILP-like 268..>344 CDD:304877 16/76 (21%)
RAC_head 332..401 CDD:293322 6/20 (30%)
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
DNAJC18NP_689899.1 DnaJ 82..143 CDD:278647 21/68 (31%)
DUF1977 250..350 CDD:286411 23/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.