DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10565 and DNAJB4

DIOPT Version :9

Sequence 1:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001304028.1 Gene:DNAJB4 / 11080 HGNCID:14886 Length:337 Species:Homo sapiens


Alignment Length:291 Identity:67/291 - (23%)
Similarity:106/291 - (36%) Gaps:109/291 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 QDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQDDDYFTCITKAYEILGTSK 139
            :|:|.:||:.|   .||::|:::|||:..|..||||.|:.     |.::.|..:.:|||:|...|
Human     3 KDYYCILGIEK---GASDEDIKKAYRKQALKFHPDKNKSP-----QAEEKFKEVAEAYEVLSDPK 59

  Fly   140 PRRSFDSV-------------------------DPE------FDDSLP---------------SQ 158
            .|..:|..                         ||.      |..|.|               .:
Human    60 KREIYDQFGEEGLKGGAGGTDGQGGTFRYTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEE 124

  Fly   159 NDIDNDYFGVFNKFFTLNG-----------RWSEKPHVPSFGQVDAKREEVERFYN--------- 203
            .:||.|.|..|.  |::||           |..:.|.|     :...|..:|..|:         
Human   125 MEIDGDPFSAFG--FSMNGYPRDRNSVGPSRLKQDPPV-----IHELRVSLEEIYSGCTKRMKIS 182

  Fly   204 ---FWYDFKSWREFSYLDEEDK------EKGQDRDERRWIEKENRAARIKRKKEEMSRIRSL-VD 258
               ...|.:|:|      .|||      :||       |  ||.......|:.:|..  .|: .|
Human   183 RKRLNADGRSYR------SEDKILTIEIKKG-------W--KEGTKITFPREGDETP--NSIPAD 230

  Fly   259 LAY-NNDKRIQRFKQEEKDRKAAAKRAKMDA 288
            :.: ..||...:||::..:....||.:..:|
Human   231 IVFIIKDKDHPKFKRDGSNIIYTAKISLREA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 64/282 (23%)
DnaJ 76..145 CDD:278647 25/68 (37%)
RILP-like 268..>344 CDD:304877 5/21 (24%)
RAC_head 332..401 CDD:293322
SANT 584..633 CDD:197842
SANT 585..632 CDD:238096
DNAJB4NP_001304028.1 DnaJ 1..332 CDD:223560 67/291 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.