DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rtn4rl2b and Fili

DIOPT Version :9

Sequence 1:NP_982350.1 Gene:rtn4rl2b / 403309 ZFINID:ZDB-GENE-040310-2 Length:457 Species:Danio rerio
Sequence 2:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster


Alignment Length:367 Identity:90/367 - (24%)
Similarity:133/367 - (36%) Gaps:119/367 - (32%)


- Green bases have known domain annotations that are detailed below.


Zfish    33 CRCAPGQACPR-LCV--------------------------------CYHMPMTVSCQSQNFTSV 64
            |:|..|:|..| |||                                .::|.:.:...|||....
  Fly    46 CQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIET 110

Zfish    65 PAGVPYDSQ----RVFLQNNRITELRADSFGFETQVLW--LYSNNITWIEAGAFSNLRVLEELDL 123
            .....::.|    .:.|..|.::.|...:|...|.:|.  |..|.|..:...|.|:|..|.||||
  Fly   111 LGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDL 175

Zfish   124 SDNPSLRRLDGGAFRGLERLQSL----------------HMHRCH-------------------- 152
            ::| ::..|:...|:|:..|:.|                |:|...                    
  Fly   176 TNN-NIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGL 239

Zfish   153 ------------LTELPADLFHKLYSLQFLYLQENQLTNLPDGLFSDLVNLTHLFLHGNRIRTVS 205
                        ::||....|..|.||:.|.|.:|.||.:|....|.|.|||:|.|.|||...:.
  Fly   240 KELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLP 304

Zfish   206 ENAFRGLVNLDRLLLHDNR---IRQVHRRSFRDLGRLTILYLFNN-SLQELP------------- 253
            ..||..|.:|..  ||.:|   ::::..|:|.|...|..|:|.|| .|.::|             
  Fly   305 AVAFLNLFHLRE--LHLSRLDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEV 367

Zfish   254 ---GQALRDTSSVQF-------LRLNGNPWTCGCEARSLWEW 285
               ..:|:...|.||       |.|..||..|.|..  ||.|
  Fly   368 YMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSL--LWLW 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rtn4rl2bNP_982350.1 LRRNT 40..71 CDD:214470 9/63 (14%)
leucine-rich repeat 53..70 CDD:275380 3/16 (19%)
leucine-rich repeat 73..93 CDD:275380 5/23 (22%)
LRR_RI 93..>326 CDD:238064 73/270 (27%)
LRR_8 95..153 CDD:290566 20/107 (19%)
leucine-rich repeat 95..117 CDD:275380 7/23 (30%)
leucine-rich repeat 118..142 CDD:275380 9/23 (39%)
leucine-rich repeat 143..166 CDD:275380 8/70 (11%)
LRR_8 166..225 CDD:290566 25/61 (41%)
LRR_4 166..206 CDD:289563 18/39 (46%)
leucine-rich repeat 167..190 CDD:275380 9/22 (41%)
leucine-rich repeat 191..214 CDD:275380 10/22 (45%)
LRR_8 214..272 CDD:290566 20/84 (24%)
leucine-rich repeat 215..238 CDD:275380 7/25 (28%)
leucine-rich repeat 239..262 CDD:275380 8/39 (21%)
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 0/21 (0%)
leucine-rich repeat 98..121 CDD:275380 4/22 (18%)
LRR_8 120..180 CDD:404697 18/60 (30%)
leucine-rich repeat 122..145 CDD:275380 4/22 (18%)
leucine-rich repeat 146..169 CDD:275380 7/22 (32%)
LRR <161..>354 CDD:227223 54/195 (28%)
leucine-rich repeat 170..193 CDD:275380 9/23 (39%)
leucine-rich repeat 194..217 CDD:275380 3/22 (14%)
leucine-rich repeat 218..265 CDD:275380 4/46 (9%)
leucine-rich repeat 266..289 CDD:275380 9/22 (41%)
leucine-rich repeat 290..313 CDD:275380 10/22 (45%)
leucine-rich repeat 314..338 CDD:275380 7/25 (28%)
LRR_8 337..397 CDD:404697 14/59 (24%)
leucine-rich repeat 339..360 CDD:275380 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.