DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and CYTH1

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001351969.1 Gene:CYTH1 / 9267 HGNCID:9501 Length:399 Species:Homo sapiens


Alignment Length:252 Identity:96/252 - (38%)
Similarity:149/252 - (59%) Gaps:18/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 DDHAISSHTSAAQYEQHEQQQHEQQQLQA--------AAAAAGVAQNYKMSE----TIRKRQYRV 772
            ::..:.|..:|.:.::.|..:..:|:|.|        .|..|...:|...:|    ..|.:|..:
Human     6 EEEDVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAM 70

  Fly   773 GLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAM 837
            |...||..|:|||.:||....|:||.:.:|:||...:||::..||:|||. :::||:.||..|..
Human    71 GRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGE-RDEFNIQVLHAFVE 134

  Fly   838 ELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAII 902
            ..:.:...:..|||:|...||:|||||||:|:||.|:||||:||.   |..:|:||.:||:||||
Human   135 LHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNN---GVFQSTDTCYVLSFAII 196

  Fly   903 MLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD 959
            ||||.||.||:|.  :..||.||...|||:|..|:.:::|..:|:.:|::.||...|
Human   197 MLNTSLHNPNVKD--KPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPED 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 83/187 (44%)
PH_IQSEC 981..1108 CDD:270128
CYTH1NP_001351969.1 Sec7 64..246 CDD:396096 83/187 (44%)
PH_GRP1-like 261..380 CDD:269954
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.