DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and CYTH2

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_006723535.1 Gene:CYTH2 / 9266 HGNCID:9502 Length:421 Species:Homo sapiens


Alignment Length:419 Identity:116/419 - (27%)
Similarity:195/419 - (46%) Gaps:98/419 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 EQQQHEQQQLQAAAAAAGVAQNYKMSETIRKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGV 801
            |.|:..::..:|.:...|:..|.......|.|:..:|...||..|:|||.:|:....|:|||:.:
Human    54 EIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTPEEI 118

  Fly   802 ARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKI 866
            ||||...:||::..||:|||. :.:.|:|||..|....:.:...:..|||:|...||:|||||||
Human   119 ARFLYKGEGLNKTAIGDYLGE-REELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKI 182

  Fly   867 ERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGI 931
            :|:||.|:||||.||.   |..:|:||.:||:||:|||||.||.||::.  :..:|.|:...|||
Human   183 DRMMEAFAQRYCLCNP---GVFQSTDTCYVLSFAVIMLNTSLHNPNVRD--KPGLERFVAMNRGI 242

  Fly   932 DDCHDIDKDMLMGIYDRVKSDEFK----PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLY 992
            ::..|:.:::|..:||.::::.||    .|:|                    |.|        .:
Human   243 NEGGDLPEELLRNLYDSIRNEPFKIPEDDGND--------------------LTH--------TF 279

  Fly   993 EIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKT----------SVTYTF--------RNSFP 1039
            ..||           ||.:|.       |:..:.||          :..|.|        |...|
Human   280 FNPD-----------REGWLL-------KLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIP 326

  Fly  1040 LCGTVVTLLDMPNYPFCIQL-------------SQKVDGKI------LITFNARNEHDRCKFAED 1085
            |....:..:|.|..|.|.:|             ..:.||::      :...:|..:.::.::.:.
Human   327 LENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKS 391

  Fly  1086 LKESIS-----EMDEMESLRIEAELERQK 1109
            ::.::|     ||......||..:.::::
Human   392 IQAAVSVDPFYEMLAARKKRISVKKKQEQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 79/187 (42%)
PH_IQSEC 981..1108 CDD:270128 27/168 (16%)
CYTH2XP_006723535.1 Sec7 83..265 CDD:396096 79/187 (42%)
PH_GRP1-like 280..399 CDD:269954 22/136 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.