DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and CYTH3

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_004218.1 Gene:CYTH3 / 9265 HGNCID:9504 Length:399 Species:Homo sapiens


Alignment Length:452 Identity:120/452 - (26%)
Similarity:199/452 - (44%) Gaps:123/452 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   687 GGGVGVAGGAGVYAAQMQAAVAAATAAGGMPPADDHAISSHTSAAQYEQHEQQ---QHEQQQLQA 748
            |||.|                      ||:|  :|.::..........:.:::   ..|:.:.:.
Human     5 GGGEG----------------------GGVP--EDLSLEEREELLDIRRRKKELIDDIERLKYEI 45

  Fly   749 AAAAAGVAQNYKMSE---TIRKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKG 810
            |.....:.....:.|   |.|.:|..:|...||..|:|||.:||....|:::|:.||:||...:|
Human    46 AEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEG 110

  Fly   811 LSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQ 875
            |::.:||:|||. :::||:.||..|....:.:...:..|||:|...||:|||||||:|:||.|:.
Human   111 LNKTVIGDYLGE-RDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAS 174

  Fly   876 RYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKD 940
            |||.||.   |..:|:||.:||:||||||||.||..|::.  :...|.||...|||::..|:.::
Human   175 RYCLCNP---GVFQSTDTCYVLSFAIIMLNTSLHNHNVRD--KPTAERFIAMNRGINEGGDLPEE 234

  Fly   941 MLMGIYDRVKSDEFK----PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLYEIPDVNKKE 1001
            :|..:|:.:|::.||    .|:|                    |.|        .:..||     
Human   235 LLRNLYESIKNEPFKIPEDDGND--------------------LTH--------TFFNPD----- 266

  Fly  1002 RPGVHQREVFLFNDLLVITKIFSKKKT----------SVTYTF--------RNSFPLCGTVVTLL 1048
                  ||.:|.       |:..:.||          :..|.|        |...||....:..:
Human   267 ------REGWLL-------KLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREV 318

  Fly  1049 DMPNYPFCIQL-------------SQKVDGK------ILITFNARNEHDRCKFAEDLKESIS 1091
            :.|..|.|.:|             ..:.||:      ::...:|.:..::.::.:.:|.|||
Human   319 EDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASIS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 78/187 (42%)
PH_IQSEC 981..1108 CDD:270128 25/148 (17%)
CYTH3NP_004218.1 Sec7 66..248 CDD:396096 78/187 (42%)
PH_GRP1-like 263..382 CDD:269954 24/136 (18%)
C-terminal autoinhibitory region. /evidence=ECO:0000269|PubMed:23940353 391..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148856
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.