DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and cyth2

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_005157903.1 Gene:cyth2 / 569358 ZFINID:ZDB-GENE-100921-55 Length:416 Species:Danio rerio


Alignment Length:407 Identity:117/407 - (28%)
Similarity:195/407 - (47%) Gaps:73/407 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 EQQQHEQQQLQAAAAAAGVAQNYKMSETIRK-RQYRVGLNLFNKKPEKGITYLIRRGFLENTPQG 800
            |.|:.:::..:|.....|:..:.:.|:|::| |...:|...||..|:|||.:|:....|.:||:.
Zfish    48 EIQRLKEELREAIIEVEGLETSTEGSKTLQKSRHVAMGRKKFNMDPKKGIVFLVENELLRHTPED 112

  Fly   801 VARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQK 865
            :|:||...:||::..||:|||. ::.||:.||..|....:.:...:..|||:|...||:||||||
Zfish   113 IAQFLYKGEGLNKTAIGDYLGE-RDDFNIKVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQK 176

  Fly   866 IERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRG 930
            |:|:||.|:||||.||.   |..:|:||.:||:||||||||.||.||::.  :..||.||...||
Zfish   177 IDRMMEAFAQRYCHCNP---GVFQSTDTCYVLSFAIIMLNTSLHNPNVRD--KPTVERFISMNRG 236

  Fly   931 IDDCHDIDKDMLMGIYDRVKSDEFK----PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRL 991
            |:|..|:.:::|..:||.:|::.||    .|:|                    |.|        .
Zfish   237 INDGGDLPEELLRNLYDSIKNEPFKIPEDDGND--------------------LTH--------T 273

  Fly   992 YEIPD-----VNKKERPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMP 1051
            :..||     :....|....:|..|:..|..:....::..|..     |...||....:..::.|
Zfish   274 FFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEP-----RGIIPLENLSIREVEDP 333

  Fly  1052 NYPFCIQL-------------SQKVDGKI------LITFNARNEHDRCKFAEDLKESIS-----E 1092
            ..|.|.:|             ..:.||::      :...:|....::.::...:|.::|     |
Zfish   334 RKPNCFELYIPNNRGQLIKACKTEADGRVVEGNHMVYRISAPTPEEKDEWIHSIKSAVSVDPFYE 398

  Fly  1093 MDEMESLRIEAELERQK 1109
            |......||..:.:.::
Zfish   399 MLAARKKRISLKKKEEQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 82/188 (44%)
PH_IQSEC 981..1108 CDD:270128 24/155 (15%)
cyth2XP_005157903.1 Sec7 78..260 CDD:279680 82/187 (44%)
PH_GRP1-like 275..394 CDD:269954 19/123 (15%)
PH 279..392 CDD:278594 16/117 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.