DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and Fbxo8

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_056606.2 Gene:Fbxo8 / 50753 MGIID:1354696 Length:319 Species:Mus musculus


Alignment Length:210 Identity:58/210 - (27%)
Similarity:105/210 - (50%) Gaps:39/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   757 QNYKMSETIRK--RQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEY 819
            :|..:..:.||  .|...|...||..||:|::|.:.:|.|:::|:.:|:|:...:.|:.:.:..|
Mouse   124 KNPPLGFSFRKLYMQLDEGSLTFNANPEEGVSYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIY 188

  Fly   820 LG-------------NLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGE-AQKIERLM 870
            |.             |.:|||                  :..|||:|..:...|.| .:.:|.|:
Mouse   189 LDERRDVLDDLVTLHNFRNQF------------------LPNALREFFRHIHAPEERGEYLETLI 235

  Fly   871 EIFSQRYCECNADIVGRL-RSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDC 934
            ..||.|:|.||.|::..| .|.|.::||.:::|:|:.||.:|::|  .:|...:||:|.|..  .
Mouse   236 TKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVK--NKMSKREFIRNTRRA--A 296

  Fly   935 HDIDKDMLMGIYDRV 949
            .:|.:|.:..:||.:
Mouse   297 QNISEDFVGHLYDNI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 57/201 (28%)
PH_IQSEC 981..1108 CDD:270128
Fbxo8NP_056606.2 F-box-like 74..112 CDD:372399
Sec7 133..312 CDD:238100 57/201 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.