DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and cyth1b

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_005169523.1 Gene:cyth1b / 325586 ZFINID:ZDB-GENE-030131-4311 Length:416 Species:Danio rerio


Alignment Length:194 Identity:86/194 - (44%)
Similarity:126/194 - (64%) Gaps:6/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 RKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMA 830
            |.:|..:|...||..|:|||.:||....|:||.:.:|:||...:||::..||:|||. :::||:.
Zfish    81 RSKQMAMGRKKFNMDPKKGIQFLIENELLKNTCEDIAQFLYKGEGLNKTAIGDYLGE-RDEFNIQ 144

  Fly   831 VLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIF 895
            ||..|....:.:...:..|||:|...||:|||||||:|:||.|:||||:||.   |..:|:||.:
Zfish   145 VLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNP---GVFQSTDTCY 206

  Fly   896 VLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD 959
            ||:||||||||.||.||:|.  :...|.||...|||:|..|:.:|:|..:|:.:|::.||...|
Zfish   207 VLSFAIIMLNTSLHNPNVKD--KPSAERFICMNRGINDGGDLPEDLLRNLYESIKNEPFKIPED 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 83/187 (44%)
PH_IQSEC 981..1108 CDD:270128
cyth1bXP_005169523.1 GPS2_interact 18..90 CDD:292412 3/8 (38%)
Sec7 81..263 CDD:279680 83/187 (44%)
PH_GRP1-like 278..397 CDD:269954
PH 282..395 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.