DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and CYTH4

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_037517.1 Gene:CYTH4 / 27128 HGNCID:9505 Length:394 Species:Homo sapiens


Alignment Length:414 Identity:118/414 - (28%)
Similarity:192/414 - (46%) Gaps:83/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 HAISSHTSAAQYEQHEQQQHEQQQL---------QAAAAAAGV-----AQNYKMSETIRKRQYRV 772
            |...:..|:.:.|:.::.:..::||         :.|...|.:     |:..:|::  ::::..:
Human     5 HPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ--KEKELCI 67

  Fly   773 GLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAM 837
            |...||..|.|||.|.|....|....|.:||||...:||::..||.|||. ::..|:.||..|..
Human    68 GRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGE-RDPINLQVLQAFVD 131

  Fly   838 ELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAII 902
            ..:.:...:..|||:|...||:|||||||:|:||.|:.|||.||.   |..:|:||.:||:|:||
Human   132 CHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNP---GVFQSTDTCYVLSFSII 193

  Fly   903 MLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFK----PGSDHVTQ 963
            ||||.||.||::.  |...|.|:...|||::..|:.:|.|..::|.:||:.|.    .|:|    
Human   194 MLNTSLHNPNVRD--RPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKSEPFSIPEDDGND---- 252

  Fly   964 VMKVQATIVGKKPNLALPHRRLVCYCRLYEIPD-----VNKKERPGVHQREVFLFNDLLVITKIF 1023
                            |.|        .:..||     :....|....:|..|:..|..:....|
Human   253 ----------------LTH--------TFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEF 293

  Fly  1024 SKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQL------SQKV-------DGKIL------I 1069
            :..|..     |...||....|..:|.|..|||::|      .||:       ||:::      .
Human   294 TTDKEP-----RGIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESY 353

  Fly  1070 TFNARNEHDRCKFAEDLKESISEM 1093
            ..:|.:..:|.::.|.::.||:.:
Human   354 RISATSAEERDQWIESIRASITRV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 77/187 (41%)
PH_IQSEC 981..1108 CDD:270128 28/137 (20%)
CYTH4NP_037517.1 Sec7 61..243 CDD:279680 77/187 (41%)
PH_GRP1-like 258..376 CDD:269954 27/122 (22%)
PH 262..374 CDD:278594 23/116 (20%)
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 268..275 1/6 (17%)
C-terminal autoinhibitory region. /evidence=ECO:0000250 386..394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.