DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and Cyth3

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_035312.3 Gene:Cyth3 / 19159 MGIID:1335107 Length:399 Species:Mus musculus


Alignment Length:369 Identity:109/369 - (29%)
Similarity:174/369 - (47%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 TIRKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFN 828
            |.|.:|..:|...||..|:|||.:||....|:::|:.||:||...:||::.:||:|||. ::.||
Mouse    64 TQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGE-RDDFN 127

  Fly   829 MAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDT 893
            :.||..|....:.:...:..|||:|...||:|||||||:|:||.|:.|||.||.   |..:|:||
Mouse   128 IKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNP---GVFQSTDT 189

  Fly   894 IFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFK--- 955
            .:||:||||||||.||..|::.  :...|.||...|||::..|:.:::|..:|:.:|::.||   
Mouse   190 CYVLSFAIIMLNTSLHNHNVRD--KPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPE 252

  Fly   956 -PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVI 1019
             .|:|                    |.|        .:..||           ||.:|.      
Mouse   253 DDGND--------------------LTH--------TFFNPD-----------REGWLL------ 272

  Fly  1020 TKIFSKKKT----------SVTYTF--------RNSFPLCGTVVTLLDMPNYPFCIQL------- 1059
             |:..:.||          :..|.|        |...||....:..::.|..|.|.:|       
Mouse   273 -KLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKG 336

  Fly  1060 ------SQKVDGK------ILITFNARNEHDRCKFAEDLKESIS 1091
                  ..:.||:      ::...:|.:..::.::.:.:|.|||
Mouse   337 QVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASIS 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 78/187 (42%)
PH_IQSEC 981..1108 CDD:270128 25/148 (17%)
Cyth3NP_035312.3 Sec7 66..248 CDD:396096 78/187 (42%)
PH_GRP1-like 263..382 CDD:269954 24/136 (18%)
Phosphatidylinositol 3,4,5-trisphosphate binding 273..280 1/6 (17%)
C-terminal autoinhibitory region 391..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838934
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.