DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and Cyth2

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_035311.1 Gene:Cyth2 / 19158 MGIID:1334255 Length:400 Species:Mus musculus


Alignment Length:410 Identity:114/410 - (27%)
Similarity:195/410 - (47%) Gaps:79/410 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 EQQQHEQQQLQAAAAAAGVAQNYKMSETIRKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGV 801
            |.|:..::..:|.:...|:..|.......|.|:..:|...||..|:|||.:|:....|:|||:.:
Mouse    32 EIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEI 96

  Fly   802 ARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKI 866
            ||||...:||::..||:|||. :.:.|::||..|....:.:...:..|||:|...||:|||||||
Mouse    97 ARFLYKGEGLNKTAIGDYLGE-REELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKI 160

  Fly   867 ERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGI 931
            :|:||.|:||||.||.   |..:|:||.:||:||:|||||.||.||::.  :..:|.|:...|||
Mouse   161 DRMMEAFAQRYCLCNP---GVFQSTDTCYVLSFAVIMLNTSLHNPNVRD--KPGLERFVAMNRGI 220

  Fly   932 DDCHDIDKDMLMGIYDRVKSDEFK----PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLY 992
            ::..|:.:|:|..:||.::::.||    .|:|                    |.|        .:
Mouse   221 NEGGDLPEDLLRNLYDSIRNEPFKIPEDDGND--------------------LTH--------TF 257

  Fly   993 EIPDVNKKE---------RPGVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLL 1048
            ..||   :|         |....:|..|:..|..:....::..|..     |...||....:..:
Mouse   258 FNPD---REGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP-----RGIIPLENLSIREV 314

  Fly  1049 DMPNYPFCIQL-------------SQKVDGKI------LITFNARNEHDRCKFAEDLKESIS--- 1091
            |.|..|.|.:|             ..:.||::      :...:|..:.::.::.:.::.::|   
Mouse   315 DDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVSVDP 379

  Fly  1092 --EMDEMESLRIEAELERQK 1109
              ||......||..:.::::
Mouse   380 FYEMLAARKKRISVKKKQEQ 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 79/187 (42%)
PH_IQSEC 981..1108 CDD:270128 25/159 (16%)
Cyth2NP_035311.1 Sec7 61..243 CDD:396096 79/187 (42%)
PH_GRP1-like 258..378 CDD:269954 20/127 (16%)
C-terminal autoinhibitory region. /evidence=ECO:0000250 387..395 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838930
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.