DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and Cyth1

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_001106170.1 Gene:Cyth1 / 19157 MGIID:1334257 Length:400 Species:Mus musculus


Alignment Length:248 Identity:95/248 - (38%)
Similarity:148/248 - (59%) Gaps:18/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   724 ISSHTSAAQYEQHEQQQHEQQQLQA--------AAAAAGVAQNYKMSE----TIRKRQYRVGLNL 776
            :.|..:|.:.::.|..:..:|:|.|        .|..|...::...:|    ..|.:|..:|...
Mouse    10 VPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNMQRNKQVAMGRKK 74

  Fly   777 FNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDL 841
            ||..|:|||.:||..|.|:||.:.:|:||...:||::..||:|||. :::|::.||..|....:.
Mouse    75 FNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGE-RDEFSIQVLHAFVELHEF 138

  Fly   842 SGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNT 906
            :...:..|||:|...||:|||||||:|:||.|:||||:||   .|..:|:||.:||:||||||||
Mouse   139 TDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCN---TGVFQSTDTCYVLSFAIIMLNT 200

  Fly   907 DLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD 959
            .||.||:|.  :..||.||...|||:|..|:.:::|..:|:.:|::.||...|
Mouse   201 SLHNPNVKD--KPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPED 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 83/187 (44%)
PH_IQSEC 981..1108 CDD:270128
Cyth1NP_001106170.1 DUF342 <8..90 CDD:302792 20/79 (25%)
Sec7 64..246 CDD:279680 83/187 (44%)
PH_GRP1-like 261..381 CDD:269954
PH 265..379 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.