DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and Cyth3

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_038944952.1 Gene:Cyth3 / 116693 RGDID:620399 Length:471 Species:Rattus norvegicus


Alignment Length:369 Identity:109/369 - (29%)
Similarity:174/369 - (47%) Gaps:93/369 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   764 TIRKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFN 828
            |.|.:|..:|...||..|:|||.:||....|:::|:.||:||...:||::.:||:|||. ::.||
  Rat   136 TQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGE-RDDFN 199

  Fly   829 MAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDT 893
            :.||..|....:.:...:..|||:|...||:|||||||:|:||.|:.|||.||.   |..:|:||
  Rat   200 IKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNP---GVFQSTDT 261

  Fly   894 IFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFK--- 955
            .:||:||||||||.||..|::.  :...|.||...|||::..|:.:::|..:|:.:|::.||   
  Rat   262 CYVLSFAIIMLNTSLHNHNVRD--KPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPE 324

  Fly   956 -PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVI 1019
             .|:|                    |.|        .:..||           ||.:|.      
  Rat   325 DDGND--------------------LTH--------TFFNPD-----------REGWLL------ 344

  Fly  1020 TKIFSKKKT----------SVTYTF--------RNSFPLCGTVVTLLDMPNYPFCIQL------- 1059
             |:..:.||          :..|.|        |...||....:..::.|..|.|.:|       
  Rat   345 -KLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKG 408

  Fly  1060 ------SQKVDGK------ILITFNARNEHDRCKFAEDLKESIS 1091
                  ..:.||:      ::...:|.:..::.::.:.:|.|||
  Rat   409 QVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASIS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 78/187 (42%)
PH_IQSEC 981..1108 CDD:270128 25/148 (17%)
Cyth3XP_038944952.1 Sec7 138..320 CDD:396096 78/187 (42%)
PH_GRP1-like 335..454 CDD:269954 24/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342738
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.