DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and Cyth1

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:NP_446362.1 Gene:Cyth1 / 116691 RGDID:620397 Length:398 Species:Rattus norvegicus


Alignment Length:252 Identity:97/252 - (38%)
Similarity:150/252 - (59%) Gaps:18/252 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 DDHAISSHTSAAQYEQHEQQQHEQQQLQA--------AAAAAGVAQNYKMSE----TIRKRQYRV 772
            ||..:.|..:|.:.::.|..:..:|:|.|        .|..|...::...:|    ..|.:|..:
  Rat     4 DDSYVPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNMQRNKQVAM 68

  Fly   773 GLNLFNKKPEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAM 837
            |...||..|:|||.:||..|.|:||.:.:|:||...:||::..||:|||. :::|::.||..|..
  Rat    69 GRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGE-RDEFSIQVLHAFVE 132

  Fly   838 ELDLSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAII 902
            ..:.:...:..|||:|...||:|||||||:|:||.|:||||:||   .|..:|:||.:||:||||
  Rat   133 LHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCN---TGVFQSTDTCYVLSFAII 194

  Fly   903 MLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSD 959
            ||||.||.||:|.  :..||.||...|||:|..|:.:::|..:|:.:|::.||...|
  Rat   195 MLNTSLHNPNVKD--KPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPED 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 83/187 (44%)
PH_IQSEC 981..1108 CDD:270128
Cyth1NP_446362.1 Sec7 62..244 CDD:307500 83/187 (44%)
PH_GRP1-like 259..379 CDD:269954
Phosphatidylinositol 3,4,5-trisphosphate binding. /evidence=ECO:0000250 269..277
C-terminal autoinhibitory region. /evidence=ECO:0000250 388..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.