DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and LOC101886286

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_005169554.1 Gene:LOC101886286 / 101886286 -ID:- Length:297 Species:Danio rerio


Alignment Length:305 Identity:58/305 - (19%)
Similarity:104/305 - (34%) Gaps:101/305 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   890 SSDTIFVLAFAIIMLNTDL---HTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLM----GIY- 946
            |...::.:.|.:..::.|.   .||..|              ||....:.:.|.:::    |.| 
Zfish     9 SGALLYKMGFLVRKVHADCDGKRTPRGK--------------RGWKTFYAVLKGLILYLQKGEYR 59

  Fly   947 -DRVKSDEFKPGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCR-------LYEIPDVNKKERP 1003
             |:..|||....:..:...:.::||...|:||        |.|.|       |::.|:..:.:. 
Zfish    60 PDKQLSDEDLKNAVSIHHSLAIRATDYSKRPN--------VFYLRTADWRVYLFQAPNAEQMQS- 115

  Fly  1004 GVHQREVFLFNDLLVITKIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKIL 1068
                          .||:|                   .||..:...|..|..|. |||...:.|
Zfish   116 --------------WITRI-------------------NTVAAMFSAPPLPAAIG-SQKKFSRPL 146

  Fly  1069 ITFNAR--NEHDRCKFAEDLKESIS---------------EMDEMESLRIEAE-LERQK------ 1109
            :..:|.  ::.::.:..|....|||               :..|:|..|:..| ||.:|      
Zfish   147 LPGSASKLSQEEQVQAHETRFRSISTELAQLRSYPPDRKVKGRELEEYRLREEYLEFEKTRYETY 211

  Fly  1110 SARNRAPGNAENRDSGVADVEVCPCPYQQGSQASGEQAPNSADNS 1154
            |...||.....:.|..|.:..:    .::|:....:.:|...|:|
Zfish   212 SMLLRAKQRCGDDDLSVFEAML----LEEGALQRAQSSPTLQDSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 14/72 (19%)
PH_IQSEC 981..1108 CDD:270128 28/151 (19%)
LOC101886286XP_005169554.1 PH_EFA6 11..133 CDD:270107 30/177 (17%)
PH 13..121 CDD:278594 27/163 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5307
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.