DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment siz and cyth1

DIOPT Version :9

Sequence 1:NP_730594.1 Gene:siz / 40327 FlyBaseID:FBgn0026179 Length:1325 Species:Drosophila melanogaster
Sequence 2:XP_004916381.1 Gene:cyth1 / 100379752 XenbaseID:XB-GENE-986107 Length:405 Species:Xenopus tropicalis


Alignment Length:426 Identity:121/426 - (28%)
Similarity:195/426 - (45%) Gaps:101/426 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   737 EQQQHEQQQLQAAAAAAGVAQNYKMSETIRKRQYRVGLNLFNKKPEKGITYLIRRGFLENTPQGV 801
            |.|:...:..:|.....|:..|.......|.|:..:|...||..|:|||.||.....|.|||:.:
 Frog    32 EIQRLRDELSEAMNEVEGLEANEGSKTLQRNRKMGMGRKKFNMDPKKGIVYLQENELLRNTPEDI 96

  Fly   802 ARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELDLSGRQVDVALRKFQAYFRMPGEAQKI 866
            ||||...:||::..||:|||. ::.||::||..|....:.:...:..|||:|...||:|||||||
 Frog    97 ARFLYKGEGLNKTAIGDYLGE-RDDFNISVLHSFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKI 160

  Fly   867 ERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFAIIMLNTDLHTPNLKPERRMRVEDFIKNLRGI 931
            :|:||.|:||||.||.   |..:|:||.:||:||:|||||.||.||::.  :..||.||...|||
 Frog   161 DRMMEAFAQRYCICNP---GVFQSTDTCYVLSFAVIMLNTSLHNPNVRD--KPGVERFISMNRGI 220

  Fly   932 DDCHDIDKDMLMGIYDRVKSDEFK----PGSDHVTQVMKVQATIVGKKPNLALPHRRLVCYCRLY 992
            :|..|:.:::|..:||.::::.||    .|:|                    |.|        .:
 Frog   221 NDGGDLPEELLRNLYDSIRNEPFKIPEDDGND--------------------LTH--------TF 257

  Fly   993 EIPDVNKKERPGVHQREVFLFNDLLVITKIFSKKKT----------SVTYTF--------RNSFP 1039
            ..||           ||.:|.       |:..:.||          :..|.|        |...|
 Frog   258 FNPD-----------REGWLL-------KLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIP 304

  Fly  1040 LCGTVVTLLDMPNYPFCIQL-------------SQKVDGKI------LITFNARNEHDRCKFAED 1085
            |....:..::.|..|.|.:|             ..:.||::      :...:|....::.::.:.
 Frog   305 LENLSIREVEDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHNVYRISAPTPEEKEEWIKS 369

  Fly  1086 LKESIS-----EMDEMESLRI---EAELERQKSARN 1113
            :|.::|     ||......||   :.::::|:..::
 Frog   370 IKAAVSVDPFYEMLAARKKRISVKKKQMQQQQQEQS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sizNP_730594.1 Sec7 766..954 CDD:279680 83/187 (44%)
PH_IQSEC 981..1108 CDD:270128 27/171 (16%)
cyth1XP_004916381.1 Sec7 61..243 CDD:366596 83/187 (44%)
PH_GRP1-like 258..377 CDD:269954 22/136 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.