DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10584 and FAM86B1

DIOPT Version :10

Sequence 1:NP_649278.1 Gene:CG10584 / 40324 FlyBaseID:FBgn0037045 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_006716319.1 Gene:FAM86B1 / 85002 HGNCID:28268 Length:330 Species:Homo sapiens


Alignment Length:170 Identity:50/170 - (29%)
Similarity:75/170 - (44%) Gaps:24/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GLQVWRGALLLADYLFSKKDEFSQKTLMELGAGVGLTSIAAGIHNNGRIYCTDVDLGCILKLIRG 135
            ||..|..||.||::.......|..:|::|||:|.|||.:|.......|.|........:|:.:||
Human   135 GLVTWDAALYLAEWAIENPAAFINRTVLELGSGAGLTGLAICKMCRPRAYIFSDPHSRVLEQLRG 199

  Fly   136 NVQRNSKLL-----------RATISVLEFDFLASKEDHSQDLLEAIDNSDIILAADVIYCDTLTD 189
            ||..|...|           |.|::.|::|.....:      |.|. ..|:::||||:||.....
Human   200 NVLLNGLSLEADITGNLDSPRVTVAQLDWDVAMVHQ------LSAF-QPDVVIAADVLYCPEAIV 257

  Fly   190 AFICVLDNLLDRGRQTGRPKTIYMALEKR-----YVFTLE 224
            :.:.||..|. ..|:..|...:|:|...|     .:||.|
Human   258 SLVGVLQRLA-ACREHKRAPEVYVAFTVRNPETCQLFTTE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10584NP_649278.1 AdoMet_MTases 70..219 CDD:473071 47/163 (29%)
FAM86B1XP_006716319.1 FAM86 6..98 CDD:464362
AdoMet_MTases 135..286 CDD:473071 46/158 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.