DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and BTS1

DIOPT Version :9

Sequence 1:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_015256.1 Gene:BTS1 / 856036 SGDID:S000005990 Length:335 Species:Saccharomyces cerevisiae


Alignment Length:211 Identity:41/211 - (19%)
Similarity:82/211 - (38%) Gaps:65/211 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 HPLMKTAKHLLYNGKNTMQAWGLIVLLVSKAAGHAPSVPDVEQDKSAGVLHSQRALAEVTEMIRI 174
            |.|:|..|:...|          :::.:::       |.::.:|:          ||.|::::  
Yeast    29 HILLKPGKNFRLN----------LIVQINR-------VMNLPKDQ----------LAIVSQIV-- 64

  Fly   175 SHLVHNSVVNL-----QSSTQAGQDVDTYDDMSFGNKIGLLTGDYL----------------LGH 218
             .|:|||.:.:     .:..:.||   |...:.||....:.|.:|:                |.|
Yeast    65 -ELLHNSSLLIDDIEDNAPLRRGQ---TTSHLIFGVPSTINTANYMYFRAMQLVSQLTTKEPLYH 125

  Fly   219 SSAELANLRNQEVVEL-----ISSAVRDFSESEFIGERDEQNNPLPYKPGTFQRPSLSV--GVDF 276
            :   |..:.|:|::.|     :....|||. .|.|..::...|.:..|.|...|.:|.:  .:..
Yeast   126 N---LITIFNEELINLHRGQGLDIYWRDFL-PEIIPTQEMYLNMVMNKTGGLFRLTLRLMEALSP 186

  Fly   277 NEHDVMTPMPIAQVLG 292
            :.|...:.:|...:||
Yeast   187 SSHHGHSLVPFINLLG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 41/211 (19%)
BTS1NP_015256.1 polyprenyl_synt 20..278 CDD:395277 41/211 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.