DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and GPS1

DIOPT Version :9

Sequence 1:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001031483.1 Gene:GPS1 / 818028 AraportID:AT2G34630 Length:422 Species:Arabidopsis thaliana


Alignment Length:378 Identity:101/378 - (26%)
Similarity:170/378 - (44%) Gaps:83/378 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LLSDEIANVALHLRKLVGSAHP-LMKTAKHLLYNGKNTMQAWGLIVLLVSKAAGHAPSVPDVEQD 153
            |::||::.::..||::|.:..| |...|::....|....|....|:||::.|..  ..||:....
plant    87 LVADELSLLSNKLREMVLAEVPKLASAAEYFFKRGVQGKQFRSTILLLMATALN--VRVPEALIG 149

  Fly   154 KSAGVLHS-----QRALAEVTEMIRISHLVHNSVVNLQSSTQAGQDVDTYD-----DMSFGNKIG 208
            :|..::.|     ||.:||:||||.::.|:|:.|::         |.||..     ::..|||:.
plant   150 ESTDIVTSELRVRQRGIAEITEMIHVASLLHDDVLD---------DADTRRGVGSLNVVMGNKMS 205

  Fly   209 LLTGDYLLGHSSAELANLRNQEVVELISSAVRDFSESEFIGERDEQNNPLPYKPGTFQRPSLSVG 273
            :|.||:||..:...||.|:|.|||.|:::||    |....||..|..:      .|.||.|:   
plant   206 VLAGDFLLSRACGALAALKNTEVVALLATAV----EHLVTGETMEITS------STEQRYSM--- 257

  Fly   274 VDFNEHDVMTPMPIAQVLGNPEEEWECRNILNAGSLLGKSCQASLKLAGQSEELQRHAYRFGKHL 338
                                  :.:..:......||:..||:|...|.||:.|:...|:.:|::|
plant   258 ----------------------DYYMQKTYYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNL 300

  Fly   339 ALAWQACLDAEPFQCPQLPL------DVTFSLVSAPVLFHLEHDPGMYSQLEAGKQSVDNIDYDK 397
            .||:|...|...|......|      |:...:::||:||.:|..|.:...::..::...|:|   
plant   301 GLAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAMEEFPQLREVVDQVEKDPRNVD--- 362

  Fly   398 IHKAILAGPALAKTKELQR------KHTAAALAVLQHFPATD------ARQAL 438
                 :|...|.|:|.:||      :|...|.|.:...|.||      :|:||
plant   363 -----IALEYLGKSKGIQRARELAMEHANLAAAAIGSLPETDNEDVKRSRRAL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 101/378 (27%)
GPS1NP_001031483.1 PLN02890 1..422 CDD:178478 101/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12001
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.