DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and fdps

DIOPT Version :10

Sequence 1:NP_649277.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001020642.1 Gene:fdps / 552997 ZFINID:ZDB-GENE-050506-78 Length:356 Species:Danio rerio


Alignment Length:53 Identity:21/53 - (39%)
Similarity:27/53 - (50%) Gaps:5/53 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LQTFTSQRWTSTTTTSGKHASPQVTTPPPRHDWNRAVSEA-ERIVGYPTSFLS 86
            |:.||.   ||..|..|: |...:|.||.:.|.||...|. :.||.|.|:|.|
Zfish   160 LELFTE---TSFQTELGQ-ALDLMTAPPHKIDLNRFTMERYKAIVKYKTAFYS 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_649277.1 Isoprenoid_Biosyn_C1 86..441 CDD:469660 1/1 (100%)
fdpsNP_001020642.1 polyprenyl_synt 48..309 CDD:459773 21/53 (40%)

Return to query results.
Submit another query.