DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and qless

DIOPT Version :9

Sequence 1:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001287619.1 Gene:qless / 43697 FlyBaseID:FBgn0051005 Length:436 Species:Drosophila melanogaster


Alignment Length:364 Identity:76/364 - (20%)
Similarity:161/364 - (44%) Gaps:68/364 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LLSDEIANVALHLRKLV--GSAHPLMKTAKHLLYNGKNTMQAWGLIVLLVSKAAGHAPSVPDVEQ 152
            :|.|::......:|.|:  |::.|.:.|.....::|:..... .::.:|::||..:..:      
  Fly   116 ILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYFDGQGKALR-PMVTMLMAKAINYHLN------ 173

  Fly   153 DKSAGVLHSQRALAEVTEMIRISHLVHNSVVNLQSSTQAGQ-DVDTYDDMSFGNKIGLLTGDYLL 216
            ::|..::|.||.:|..:||:..:.|||:.|:: ||..:.|: .|:..    :.:|...:.|||:|
  Fly   174 NESHQLVHKQRQIALFSEMVHSASLVHDDVID-QSDFRRGKPSVNAL----WNHKKVTMAGDYIL 233

  Fly   217 GHSSAELANLRNQEVVELISSAVRDFSESEF--IGERDEQNNPLP-YKPGTFQRPSLSVGVDFNE 278
            ..:|..:|.||:.:|..::|..:.|..:.||  :|.|:.:|.... |...|:::           
  Fly   234 SIASIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSRETENERFAHYLTKTYRK----------- 287

  Fly   279 HDVMTPMPIAQVLGNPEEEWECRNILNAGSLLGKSCQASLKLAGQSEELQRHAYRFGKHLALAWQ 343
                                       ..||:..:.:|:..:|...:.:...|:::|:::.||:|
  Fly   288 ---------------------------TASLIANALKATAVIAQADDNVAEVAFQYGRNIGLAFQ 325

  Fly   344 ACLDAEPF--QCPQL----PLDVTFSLVSAPVLFHLEHDPGMYSQLEAGKQSVDNID--YDKIHK 400
            ...|...|  ...|:    ..|:...|.:|||||..|..|.:...:........:::  ::.:||
  Fly   326 LVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEKYPELNPMVMRRFSEPGDVERAFELVHK 390

  Fly   401 AILAGPALAKTKELQRKHTAAALAVLQHFPATDARQALE 439
            :    ..|.:|:.|.:||...|:.:.|....:..::.|:
  Fly   391 S----HGLEQTRFLAKKHCNEAIRLAQELTESPYQKGLQ 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 76/364 (21%)
qlessNP_001287619.1 Isoprenoid_Biosyn_C1 117..435 CDD:294142 76/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12001
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.