DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and Fpps

DIOPT Version :9

Sequence 1:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_477380.1 Gene:Fpps / 36209 FlyBaseID:FBgn0025373 Length:419 Species:Drosophila melanogaster


Alignment Length:212 Identity:42/212 - (19%)
Similarity:81/212 - (38%) Gaps:49/212 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MYRASGLRIMQQMRRRIPVELQPL----QVAKAAPALQTFTS--------------QRWTSTTTT 49
            |::.:.:.:.||.....|:.||.|    ....|.|.:::..:              ::.:.|.:|
  Fly     1 MFKLARMLLPQQRILASPLRLQRLISTSDEVNAEPIIKSMDTIGGLPTELVNEQKLKKTSRTLST 65

  Fly    50 SGKHASP---QVTTPPPRHDWNRAVSEAERIVGYPTSFLSLRWLLSDEIANVALHLRKLVGSAHP 111
            ...|:.|   :||           ||:.|     ...|:::...|..:|..|.    |....:..
  Fly    66 LQNHSVPIAARVT-----------VSKDE-----SRDFMAVFPDLVRDITTVT----KAYNCSDA 110

  Fly   112 LMKTAKHLLYNGKNTMQAWGLIVLLVSKAAGHAPSVPDVEQDKSAGVLHSQRALAEVTEMIRISH 176
            ....|:.|.||.....:..|::.:|..|..     ||  .||.:...:...:.|....||::...
  Fly   111 AKWFAQVLQYNVPRGKKNRGILTVLTYKNL-----VP--TQDLTPENIKLAQYLGWCVEMLQSFF 168

  Fly   177 LVHNSVVNLQSSTQAGQ 193
            ::.:.|:: .|:|:.||
  Fly   169 IISDDVMD-NSTTRRGQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 23/108 (21%)
FppsNP_477380.1 polyprenyl_synt 119..377 CDD:278763 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.