DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and Ggps1

DIOPT Version :9

Sequence 1:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001007627.1 Gene:Ggps1 / 291211 RGDID:1359680 Length:300 Species:Rattus norvegicus


Alignment Length:323 Identity:62/323 - (19%)
Similarity:104/323 - (32%) Gaps:111/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LMKTAKHLL-YNGKNTMQAWGLIVLLVSKAAGHAPSVPDVEQDKSAGVLHSQRALAEVTEMIRIS 175
            |::..|:|| ..||.       :...:|:|..|...||   :||       .:.:.|||||:   
  Rat    12 LLEPYKYLLQLPGKQ-------VRTKLSQAFNHWLKVP---EDK-------LQIIIEVTEML--- 56

  Fly   176 HLVHNSVVNLQSSTQAGQDVDTYDDMSFGNKIGLLTGDYLLGHSSAELANLRNQEVVELISSAVR 240
               ||:.:.:             ||:...:|   |...:.:.||            :..:.|.:.
  Rat    57 ---HNASLLI-------------DDIEDSSK---LRRGFPVAHS------------IYGVPSVIN 90

  Fly   241 DFSESEFIGERDEQNNPLPYKPGTFQRPSLSV----GVDFNEHDVMTPMPIAQVLGNPEEEWECR 301
            ..:...|:|.........|.....|.|..|.:    |:|....|..| .|       .|||::..
  Rat    91 SANYVYFLGLEKVLTLDHPDAVKLFTRQLLELHQGQGLDIYWRDTYT-CP-------TEEEYKAM 147

  Fly   302 NILNAGSLLGKSCQASLKLAGQSEELQRHAYRFGKHLALAWQACLDAEPFQCPQLPLDVTFSLVS 366
            .:...|.|.|.:.......:...|:|:                            ||..|..|  
  Rat   148 VLQKTGGLFGLAVGLMQLFSDYKEDLK----------------------------PLLDTLGL-- 182

  Fly   367 APVLFHLEHDPGMYSQLEAGKQSVD----------NIDYDKIHKAILAGPALAKTKELQRKHT 419
               .|.:..|   |:.|.:.:.|.:          ...:..|| ||.:.|...:.:.:.|:.|
  Rat   183 ---FFQIRDD---YANLHSKEYSENKSFCEDLTEGKFSFPTIH-AIWSRPESTQVQNILRQRT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 62/323 (19%)
Ggps1NP_001007627.1 polyprenyl_synt 9..251 CDD:395277 62/323 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.