DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdss2 and PDSS1

DIOPT Version :9

Sequence 1:NP_001287138.1 Gene:Pdss2 / 40323 FlyBaseID:FBgn0037044 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_055132.2 Gene:PDSS1 / 23590 HGNCID:17759 Length:415 Species:Homo sapiens


Alignment Length:460 Identity:100/460 - (21%)
Similarity:184/460 - (40%) Gaps:105/460 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ASGLRIMQQMRRRIPVELQPL-------QVAKAAPALQTFTSQRWTSTTTTSGKHASPQVTTPPP 63
            ::...:..|:.||..::|..:       .:..|.|.:...:  |:..||..|..|:..:.|.|  
Human    35 SAAAEVRAQVHRRKGLDLSQIPYINLVKHLTSACPNVCRIS--RFHHTTPDSKTHSGEKYTDP-- 95

  Fly    64 RHDWNRAVSEAERIVGYPTSFLSLRWLLSDEIANVALHLRK--LVGSAHPLMKTAKHLLYNGKNT 126
                            :...:..|:.|..|        :||  |:.::.  :|......::||. 
Human    96 ----------------FKLGWRDLKGLYED--------IRKELLISTSE--LKEMSEYYFDGKG- 133

  Fly   127 MQAW-GLIVLLVSKAAGHAPSVPDVEQDKSAGVLHSQRALAEVTEMIRISHLVHNSVVNLQSSTQ 190
             :|: .:||.|:::|.       ::..:.|..|..||||:|.:.|||..:.|||:.|::..||.:
Human   134 -KAFRPIIVALMARAC-------NIHHNNSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRR 190

  Fly   191 AGQDVDTYDDMSFGNKIGLLTGDYLLGHSSAELANLRNQEVVELISSAVRDFSESEF--IGERDE 253
            ....|:..    :|.|..:|.||.:|..:|..||.:.|..|:.:::..:.|....||  :|.::.
Human   191 GKHTVNKI----WGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKEN 251

  Fly   254 QNNPLP-YKPGTFQRPSLSVGVDFNEHDVMTPMPIAQVLGNPEEEWECRNILNAGSLLGKSCQAS 317
            :|.... |...||::                                      ..||:..||:|.
Human   252 ENERFAHYLEKTFKK--------------------------------------TASLIANSCKAV 278

  Fly   318 LKLAGQSEELQRHAYRFGKHLALAWQACLDAEPF-QCPQ-----LPLDVTFSLVSAPVLFHLEHD 376
            ..|......:...||::||::.:|:|...|...| .|..     ...|:...|.:.||||..:..
Human   279 SVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQF 343

  Fly   377 PGMYSQLEAGKQSVDNIDYDKIHKAILAGPALAKTKELQRKHTAAA---LAVLQHFPATDARQAL 438
            |.|.:.: ..:.|:.. |.|:..:.:|....:.:|..|.:::...|   ::.|:..|..||...|
Human   344 PEMNAMI-MRRFSLPG-DVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQL 406

  Fly   439 ENIIL 443
            ..|:|
Human   407 SEIVL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdss2NP_001287138.1 Isoprenoid_Biosyn_C1 86..441 CDD:294142 85/369 (23%)
PDSS1NP_055132.2 PLN02890 6..415 CDD:178478 100/460 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..35 100/460 (22%)
Isoprenoid_Biosyn_C1 102..413 CDD:294142 87/373 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0142
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.