DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and AT3G57465

DIOPT Version :9

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_001327018.1 Gene:AT3G57465 / 28719409 AraportID:AT3G57465 Length:100 Species:Arabidopsis thaliana


Alignment Length:86 Identity:23/86 - (26%)
Similarity:37/86 - (43%) Gaps:6/86 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 YPALEAGLTYGLYIGDKGLVMRVSGYNEKLPLLVEIILNMMQTIELDIGQVNAFKDLKKRQIYNA 692
            |.|..|||.|.|.:.|.|..:.:.|:::||.:.....|:.::..:|    .|....|..|.....
plant     9 YYAQVAGLHYRLSLSDNGFELSLVGFSQKLRIEKLDALSFLKAEDL----ANFVPMLLSRTFVEC 69

  Fly   693 LINGKSLNLDLRLSILENKRF 713
            .|.|  :|:...:.|..|..|
plant    70 YIAG--VNIIPVVDIYTNTTF 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 23/86 (27%)
Peptidase_M16 85..214 CDD:279066
Peptidase_M16_C 244..419 CDD:282978
Peptidase_M16_M 436..720 CDD:292805 23/86 (27%)
Peptidase_M16_C 724..907 CDD:282978
AT3G57465NP_001327018.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1008844at2759
OrthoFinder 1 1.000 - - FOG0000548
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.