DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10588 and ucr-2.2

DIOPT Version :9

Sequence 1:NP_001287135.1 Gene:CG10588 / 40316 FlyBaseID:FBgn0037037 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_510521.1 Gene:ucr-2.2 / 181611 WormBaseID:WBGene00011679 Length:422 Species:Caenorhabditis elegans


Alignment Length:215 Identity:53/215 - (24%)
Similarity:74/215 - (34%) Gaps:91/215 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 AMSRERSAVQSEFEQTHMRDEVRRDQILASLASEGYPHGTFSWGNYKTLKE--GVDDSSLHKELH 248
            |.||...|.|:....| :|:.|.||       ::.|...|..|    ||.:  ||        |.
 Worm    51 AGSRYEKANQAGLSHT-IRNFVGRD-------TQEYFGNTVVW----TLSQTGGV--------LK 95

  Fly   249 KF-YRDHYGSNRMVVALQAQLSLDELEELLVRHCADIPTSQQNSIDVSQLNYQKAFRDQFYKDVF 312
            .| .||.:|           :||            .|| .:..|:.:|.|. |.|....|     
 Worm    96 SFTSRDLFG-----------VSL------------TIP-RESTSVGLSVLG-QVAGNPGF----- 130

  Fly   313 LVQP--VEDVCKLELTWVLPPMK--NFYRSKPDMFISQL--IGYEG-------------VGSLCA 358
              :|  |||        |||.|:  |.||:..|:.:.|:  ..|..             :||:|.
 Worm   131 --KPWEVED--------VLPTMRADNGYRTAYDLVVDQIHKAAYRNGGLGNSIYAPCSKIGSICT 185

  Fly   359 YLRHHLWCISVVAGVAESSF 378
                     |.::..||..|
 Worm   186 ---------STLSSFAEQHF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10588NP_001287135.1 Ptr 27..980 CDD:223956 53/215 (25%)
Peptidase_M16 85..214 CDD:279066 10/27 (37%)
Peptidase_M16_C 244..419 CDD:282978 36/155 (23%)
Peptidase_M16_M 436..720 CDD:292805
Peptidase_M16_C 724..907 CDD:282978
ucr-2.2NP_510521.1 PqqL 23..401 CDD:223685 53/215 (25%)
Peptidase_M16 37..176 CDD:279066 46/184 (25%)
Peptidase_M16_C 188..352 CDD:282978 3/9 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.