DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sems and TMPRSS5

DIOPT Version :9

Sequence 1:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:232 Identity:71/232 - (30%)
Similarity:110/232 - (47%) Gaps:23/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 TRVIGGRVTTNAKLGGYL-VAMRYFNNFICGGTLIHELIVLTAAHCFED--RAEKEAWSVDGGIS 103
            :|::||:.....:..... ||:.:  ...|||:::....|:|||||...  .|...:|.|..|: 
Human   216 SRIVGGQSVAPGRWPWQASVALGF--RHTCGGSVLAPRWVVTAAHCMHSFRLARLSSWRVHAGL- 277

  Fly   104 RLSEKGIRRQ----VKRFIKSAQFKMVTMNMDVAVVLLNRPM-VGKNIGTLSLCSTA----LTPG 159
             :|...:|..    |:|.|....:.....:.|||::.|...: ....:|  ::|..|    ...|
Human   278 -VSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTVG--AVCLPAKEQHFPKG 339

  Fly   160 QTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVL-GKKDACTYD 223
            ....|||||.|:|.......||:...||:...::|..:...|.:::..|.||..| |:.|||..|
Human   340 SRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYLDGRADACQGD 404

  Fly   224 SGGPLVYEK----QVCGIVSFGIGCASRRYPGVYTDV 256
            ||||||...    ::.|:||:|.|||...:||||..|
Human   405 SGGPLVCPDGDTWRLVGVVSWGRGCAEPNHPGVYAKV 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 71/231 (31%)
Tryp_SPc 44..265 CDD:238113 70/230 (30%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133
Tryp_SPc 217..448 CDD:214473 71/231 (31%)
Tryp_SPc 218..451 CDD:238113 70/230 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.